Recombinant Human FAM71C Protein, GST-tagged
| Cat.No. : | FAM71C-3793H |
| Product Overview : | Human FAM71C full-length ORF ( NP_699195.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | FAM71C (Family With Sequence Similarity 71 Member C) is a Protein Coding gene. An important paralog of this gene is FAM71A. |
| Molecular Mass : | 53.9 kDa |
| AA Sequence : | MEDCCMLPYYTAQSSPAMGMFNTSMGKLQRQLYKGEYTIFRYAPMFESDFIQISKRGEVIDVHNRARMVTMGIVRTSPCLTLPDVMLLARPAAVCDNARCGPATQKRESPPAEILELTRLLPLMFVKITIHNSVKKQLHLKLATGRSFYLQLCPPSDASEDLFVHWENLVYILRPPVEAYSDTRAILAGNTLDSSVLEEVQRSPVGYAMKFCEEKEQFRISRLHMNAEMFGSTYCDYTIEI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM71C family with sequence similarity 71, member C [ Homo sapiens ] |
| Official Symbol | FAM71C |
| Synonyms | FAM71C; family with sequence similarity 71, member C; Family With Sequence Similarity 71 Member C; Family With Sequence Similarity 71, Member C |
| Gene ID | 196472 |
| mRNA Refseq | NM_153364 |
| Protein Refseq | NP_699195 |
| UniProt ID | Q8NEG0 |
| ◆ Recombinant Proteins | ||
| FAM71C-256C | Recombinant Cynomolgus Monkey FAM71C Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM71C-347H | Recombinant Human FAM71C Protein, MYC/DDK-tagged | +Inquiry |
| FAM71C-3793H | Recombinant Human FAM71C Protein, GST-tagged | +Inquiry |
| FAM71C-1449R | Recombinant Rhesus Macaque FAM71C Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM71C-4631HF | Recombinant Full Length Human FAM71C Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM71C-6355HCL | Recombinant Human FAM71C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM71C Products
Required fields are marked with *
My Review for All FAM71C Products
Required fields are marked with *
