Recombinant Human FAM72A protein, GST-tagged

• Cat.No.: FAM72A-12724H
• Product Overview: Recombinant Human FAM72A protein(1-149 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-149 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: FAM72A family with sequence similarity 72, member A [ Homo sapiens ]
• Official Symbol: FAM72A
• Synonyms: family with sequence similarity 72, member A; 24044; Ensembl:ENSG00000196550; MGC46651, MGC57827, MGC169168, MGC182081, MGC182095; protein FAM72A;Ugene;LMP1-induced protein;latent membrane protein 1-induced protein; LMPIP; RP11-312O7.1
• Gene ID: 729533
• mRNA Refseq: NM_001123168.1
• Protein Refseq: NP_001116640.1
• MIM: 614710
• UniProt ID: Q5TYM5