Recombinant Human FAM72A protein, GST-tagged

Cat.No. : FAM72A-12724H
Product Overview : Recombinant Human FAM72A protein(1-149 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability December 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-149 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name FAM72A family with sequence similarity 72, member A [ Homo sapiens ]
Official Symbol FAM72A
Synonyms family with sequence similarity 72, member A; 24044; Ensembl:ENSG00000196550; MGC46651, MGC57827, MGC169168, MGC182081, MGC182095; protein FAM72A;Ugene;LMP1-induced protein;latent membrane protein 1-induced protein; LMPIP; RP11-312O7.1
Gene ID 729533
mRNA Refseq NM_001123168.1
Protein Refseq NP_001116640.1
MIM 614710
UniProt ID Q5TYM5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM72A Products

Required fields are marked with *

My Review for All FAM72A Products

Required fields are marked with *

0
cart-icon
0
compare icon