Recombinant Human FAM78B protein, GST-tagged
Cat.No. : | FAM78B-30192H |
Product Overview : | Recombinant Human FAM78B (176-226 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met176-Met226 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MNTTTKEKIILQTIKWRMRVDIEVDPLQLLGQRARLVGRTQQEQPRILSRM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | FAM78B family with sequence similarity 78, member B [ Homo sapiens ] |
Official Symbol | FAM78B |
Synonyms | FAM78B; family with sequence similarity 78, member B; protein FAM78B; MGC131653; |
Gene ID | 149297 |
mRNA Refseq | NM_001017961 |
Protein Refseq | NP_001017961 |
UniProt ID | Q5VT40 |
◆ Recombinant Proteins | ||
FAM78B-30192H | Recombinant Human FAM78B protein, GST-tagged | +Inquiry |
FAM78B-5643M | Recombinant Mouse FAM78B Protein | +Inquiry |
FAM78B-3091M | Recombinant Mouse FAM78B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM78B-1180H | Recombinant Human FAM78B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Fam78b-2947M | Recombinant Mouse Fam78b Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM78B-6348HCL | Recombinant Human FAM78B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM78B Products
Required fields are marked with *
My Review for All FAM78B Products
Required fields are marked with *