Recombinant Human FAM9B Protein, GST-tagged

Cat.No. : FAM9B-3821H
Product Overview : Human FAM9B full-length ORF ( NP_995321.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. [provided by RefSeq, Aug 2011]
Molecular Mass : 48.8 kDa
AA Sequence : MAAWGKKHAGKDPVRDECEERNRFTETREEDVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRMKMDKTCSKTKNKSKHALRKKQLKRQKRDYIHSLKLLNVLEEYITDEQKEEEEEEGEEEELIRIFQEQQKKWQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSELDN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM9B family with sequence similarity 9 member B [ Homo sapiens (human) ]
Official Symbol FAM9B
Synonyms FAM9B; family with sequence similarity 9 member B; Family With Sequence Similarity 9 Member B; Testis Expressed 39B; Family With Sequence Similarity 9, Member B; Protein FAM9B; TEX39B; protein FAM9B; testis expressed 39B
Gene ID 171483
mRNA Refseq NM_205849
Protein Refseq NP_995321
MIM 300478
UniProt ID Q8IZU0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM9B Products

Required fields are marked with *

My Review for All FAM9B Products

Required fields are marked with *

0
cart-icon