Recombinant Human FAM9B Protein, GST-tagged

• Cat.No.: FAM9B-3821H
• Product Overview: Human FAM9B full-length ORF ( NP_995321.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. [provided by RefSeq, Aug 2011]
• Molecular Mass: 48.8 kDa
• AA Sequence: MAAWGKKHAGKDPVRDECEERNRFTETREEDVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRMKMDKTCSKTKNKSKHALRKKQLKRQKRDYIHSLKLLNVLEEYITDEQKEEEEEEGEEEELIRIFQEQQKKWQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSELDN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM9B family with sequence similarity 9 member B [ Homo sapiens (human) ]
• Official Symbol: FAM9B
• Synonyms: FAM9B; family with sequence similarity 9 member B; Family With Sequence Similarity 9 Member B; Testis Expressed 39B; Family With Sequence Similarity 9, Member B; Protein FAM9B; TEX39B; protein FAM9B; testis expressed 39B
• Gene ID: 171483
• mRNA Refseq: NM_205849
• Protein Refseq: NP_995321
• MIM: 300478
• UniProt ID: Q8IZU0