Recombinant Human FAM9B Protein, GST-tagged
| Cat.No. : | FAM9B-3821H |
| Product Overview : | Human FAM9B full-length ORF ( NP_995321.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 48.8 kDa |
| AA Sequence : | MAAWGKKHAGKDPVRDECEERNRFTETREEDVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRMKMDKTCSKTKNKSKHALRKKQLKRQKRDYIHSLKLLNVLEEYITDEQKEEEEEEGEEEELIRIFQEQQKKWQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSELDN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM9B family with sequence similarity 9 member B [ Homo sapiens (human) ] |
| Official Symbol | FAM9B |
| Synonyms | FAM9B; family with sequence similarity 9 member B; Family With Sequence Similarity 9 Member B; Testis Expressed 39B; Family With Sequence Similarity 9, Member B; Protein FAM9B; TEX39B; protein FAM9B; testis expressed 39B |
| Gene ID | 171483 |
| mRNA Refseq | NM_205849 |
| Protein Refseq | NP_995321 |
| MIM | 300478 |
| UniProt ID | Q8IZU0 |
| ◆ Recombinant Proteins | ||
| FAM9B-3821H | Recombinant Human FAM9B Protein, GST-tagged | +Inquiry |
| FAM9B-415H | Recombinant Human FAM9B | +Inquiry |
| FAM9B-4660HF | Recombinant Full Length Human FAM9B Protein, GST-tagged | +Inquiry |
| FAM9B-3948H | Recombinant Human FAM9B protein, His-tagged | +Inquiry |
| FAM9B-3949H | Recombinant Human FAM9B protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM9B-592HCL | Recombinant Human FAM9B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM9B Products
Required fields are marked with *
My Review for All FAM9B Products
Required fields are marked with *
