Recombinant Human FANK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FANK1-2115H
Product Overview : FANK1 MS Standard C13 and N15-labeled recombinant protein (NP_660278) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Through the activation of JUN and AP-1-mediated transcription, may regulate apoptosis.
Molecular Mass : 38.4 kDa
AA Sequence : MEPQRIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FANK1 fibronectin type III and ankyrin repeat domains 1 [ Homo sapiens (human) ]
Official Symbol FANK1
Synonyms FANK1; fibronectin type III and ankyrin repeat domains 1; fibronectin type 3 and ankyrin repeat domains 1; fibronectin type 3 and ankyrin repeat domains protein 1; 1700007B22Rik; HSD13;
Gene ID 92565
mRNA Refseq NM_145235
Protein Refseq NP_660278
MIM 611640
UniProt ID Q8TC84

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FANK1 Products

Required fields are marked with *

My Review for All FANK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon