Recombinant Human FANK1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FANK1-2115H |
Product Overview : | FANK1 MS Standard C13 and N15-labeled recombinant protein (NP_660278) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Through the activation of JUN and AP-1-mediated transcription, may regulate apoptosis. |
Molecular Mass : | 38.4 kDa |
AA Sequence : | MEPQRIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FANK1 fibronectin type III and ankyrin repeat domains 1 [ Homo sapiens (human) ] |
Official Symbol | FANK1 |
Synonyms | FANK1; fibronectin type III and ankyrin repeat domains 1; fibronectin type 3 and ankyrin repeat domains 1; fibronectin type 3 and ankyrin repeat domains protein 1; 1700007B22Rik; HSD13; |
Gene ID | 92565 |
mRNA Refseq | NM_145235 |
Protein Refseq | NP_660278 |
MIM | 611640 |
UniProt ID | Q8TC84 |
◆ Recombinant Proteins | ||
Fank1-2953M | Recombinant Mouse Fank1 Protein, Myc/DDK-tagged | +Inquiry |
FANK1-4634H | Recombinant Human FANK1 protein, His-SUMO-tagged | +Inquiry |
FANK1-2270R | Recombinant Rat FANK1 Protein | +Inquiry |
FANK1-2428H | Recombinant human FANK1, His-tagged | +Inquiry |
FANK1-512C | Recombinant Cynomolgus FANK1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FANK1-6329HCL | Recombinant Human FANK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FANK1 Products
Required fields are marked with *
My Review for All FANK1 Products
Required fields are marked with *
0
Inquiry Basket