Recombinant Human FASN, GST-tagged
| Cat.No. : | FASN-21H |
| Product Overview : | Recombinant Human FASN(2378 a.a. - 2477 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGG AYGEDLGADYNLSQVCDGKVSVHVI |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FASN fatty acid synthase [ Homo sapiens ] |
| Official Symbol | FASN |
| Synonyms | FASN; fatty acid synthase; FAS; SDR27X1; short chain dehydrogenase/reductase family 27X; member 1; |
| Gene ID | 2194 |
| mRNA Refseq | NM_004104 |
| Protein Refseq | NP_004095 |
| MIM | 600212 |
| UniProt ID | P49327 |
| Chromosome Location | 17q25 |
| Pathway | AMPK signaling; Activation of gene expression by SREBF (SREBP); Defective AMN causes hereditary megaloblastic anemia 1 |
| Function | 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity; 3-oxoacyl-[acyl-carrier-protein] synthase activity; [acyl-carrier-protein] S-acetyltransferase activity |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FASN Products
Required fields are marked with *
My Review for All FASN Products
Required fields are marked with *
