Recombinant Human FASN protein, His-tagged
| Cat.No. : | FASN-2661H |
| Product Overview : | Recombinant Human FASN protein(139 - 439 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 139 - 439 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FASN fatty acid synthase [ Homo sapiens ] |
| Official Symbol | FASN |
| Synonyms | FASN; fatty acid synthase; FAS; SDR27X1; short chain dehydrogenase/reductase family 27X; member 1; short chain dehydrogenase/reductase family 27X, member 1; OA-519; MGC14367; MGC15706; |
| Gene ID | 2194 |
| mRNA Refseq | NM_004104 |
| Protein Refseq | NP_004095 |
| MIM | 600212 |
| UniProt ID | P49327 |
| ◆ Recombinant Proteins | ||
| FASN-0481H | Recombinant Human FASN Protein (Q1109-G1524), Tag Free | +Inquiry |
| FASN-718H | Recombinant Human FASN Protein, His/GST-tagged | +Inquiry |
| fasn-2181Z | Recombinant Zebrafish fasn Protein, His-tagged | +Inquiry |
| FASN-468H | Recombinant Human FASN | +Inquiry |
| FASN-5686M | Recombinant Mouse FASN Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FASN-597HCL | Recombinant Human FASN cell lysate | +Inquiry |
| FASN-344HKCL | Human FASN Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FASN Products
Required fields are marked with *
My Review for All FASN Products
Required fields are marked with *
