Recombinant Human Fatty Acid Binding Protein 5, His tagged
| Cat.No. : | FABP5-001H |
| Product Overview : | Recombinant human Fatty Acid Binding Protein 5 (2-135 aa) with C-His tag was Expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-135aa |
| Description : | This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus. |
| Tag : | C-His |
| Molecular Mass : | 16 kDa |
| AA Sequence : | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVEHHHHHHHH |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH 7.4 |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | FABP5 fatty acid binding protein 5 [ Homo sapiens (human) ] |
| Official Symbol | FABP5 |
| Synonyms | FABP5; fatty acid binding protein 5 (psoriasis-associated); fatty acid-binding protein, epidermal; E FABP; KFABP; PA FABP; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog; EFABP; E-FABP; PAFABP; PA-FABP; |
| Gene ID | 2171 |
| mRNA Refseq | NM_001444 |
| Protein Refseq | NP_001435 |
| MIM | 605168 |
| UniProt ID | Q01469 |
| ◆ Recombinant Proteins | ||
| FABP5-5426M | Recombinant Mouse FABP5 Protein | +Inquiry |
| FABP5-1537R | Recombinant Rhesus monkey FABP5 Protein, His-tagged | +Inquiry |
| FABP5-1845R | Recombinant Rat FABP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FABP5-8745H | Recombinant Human FABP5 protein, His-tagged | +Inquiry |
| FABP5-4245H | Recombinant Human FABP5 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FABP5-6476HCL | Recombinant Human FABP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP5 Products
Required fields are marked with *
My Review for All FABP5 Products
Required fields are marked with *



