Recombinant Human FBLN7 Protein, GST-tagged
Cat.No. : | FBLN7-3877H |
Product Overview : | Human FBLN7 full-length ORF (BAC04416.1, 1 a.a. - 439 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FBLN7 (Fibulin 7) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding and heparin binding. |
Molecular Mass : | 73.8 kDa |
AA Sequence : | MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKSRLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSMVCLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTPPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBLN7 fibulin 7 [ Homo sapiens ] |
Official Symbol | FBLN7 |
Synonyms | TM14; FBLN7; fibulin 7; FBLN7; Fibulin 7; FIBL-7; TM14; Fibulin-7 |
Gene ID | 129804 |
mRNA Refseq | NM_153214 |
Protein Refseq | NP_694946 |
MIM | 611551 |
UniProt ID | Q53RD9 |
◆ Recombinant Proteins | ||
FBLN7-5704M | Recombinant Mouse FBLN7 Protein | +Inquiry |
FBLN7-3877H | Recombinant Human FBLN7 Protein, GST-tagged | +Inquiry |
FBLN7-3682H | Recombinant Human FBLN7 Protein (Gly165-Phe439), N-His tagged | +Inquiry |
FBLN7-4895HF | Recombinant Full Length Human FBLN7 Protein, GST-tagged | +Inquiry |
Fbln7-228R | Recombinant Rat Fbln7 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBLN7 Products
Required fields are marked with *
My Review for All FBLN7 Products
Required fields are marked with *
0
Inquiry Basket