Recombinant Human FBN1 Protein, GST-tagged

Cat.No. : FBN1-3878H
Product Overview : Human FBN1 partial ORF ( NP_000129, 2772 a.a. - 2871 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the fibrillin family of proteins. The encoded preproprotein is proteolytically processed to generate two proteins including the extracellular matrix component fibrillin-1 and the protein hormone asprosin. Fibrillin-1 is an extracellular matrix glycoprotein that serves as a structural component of calcium-binding microfibrils. These microfibrils provide force-bearing structural support in elastic and nonelastic connective tissue throughout the body. Asprosin, secreted by white adipose tissue, has been shown to regulate glucose homeostasis. Mutations in this gene are associated with Marfan syndrome and the related MASS phenotype, as well as ectopia lentis syndrome, Weill-Marchesani syndrome, Shprintzen-Goldberg syndrome and neonatal progeroid syndrome. [provided by RefSeq, Apr 2016]
Molecular Mass : 36.74 kDa
AA Sequence : SNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBN1 fibrillin 1 [ Homo sapiens ]
Official Symbol FBN1
Synonyms FBN1; fibrillin 1; FBN, fibrillin 1 (Marfan syndrome) , MFS1, WMS; fibrillin-1; Marfan syndrome; MASS; OCTD; SGS; fibrillin 15; FBN; WMS; MFS1; SSKS; WMS2; ACMICD; GPHYSD2;
Gene ID 2200
mRNA Refseq NM_000138
Protein Refseq NP_000129
MIM 134797
UniProt ID P35555

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBN1 Products

Required fields are marked with *

My Review for All FBN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon