Recombinant Human FBN1 Protein, GST-tagged
Cat.No. : | FBN1-3878H |
Product Overview : | Human FBN1 partial ORF ( NP_000129, 2772 a.a. - 2871 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the fibrillin family of proteins. The encoded preproprotein is proteolytically processed to generate two proteins including the extracellular matrix component fibrillin-1 and the protein hormone asprosin. Fibrillin-1 is an extracellular matrix glycoprotein that serves as a structural component of calcium-binding microfibrils. These microfibrils provide force-bearing structural support in elastic and nonelastic connective tissue throughout the body. Asprosin, secreted by white adipose tissue, has been shown to regulate glucose homeostasis. Mutations in this gene are associated with Marfan syndrome and the related MASS phenotype, as well as ectopia lentis syndrome, Weill-Marchesani syndrome, Shprintzen-Goldberg syndrome and neonatal progeroid syndrome. [provided by RefSeq, Apr 2016] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBN1 fibrillin 1 [ Homo sapiens ] |
Official Symbol | FBN1 |
Synonyms | FBN1; fibrillin 1; FBN, fibrillin 1 (Marfan syndrome) , MFS1, WMS; fibrillin-1; Marfan syndrome; MASS; OCTD; SGS; fibrillin 15; FBN; WMS; MFS1; SSKS; WMS2; ACMICD; GPHYSD2; |
Gene ID | 2200 |
mRNA Refseq | NM_000138 |
Protein Refseq | NP_000129 |
MIM | 134797 |
UniProt ID | P35555 |
◆ Recombinant Proteins | ||
FBN1-281H | Recombinant Human FBN1 protein, His-tagged | +Inquiry |
FBN1-2621H | Recombinant Human FBN1 protein, His & GST-tagged | +Inquiry |
Fbn1-2627M | Recombinant Mouse Fbn1 protein, His-tagged | +Inquiry |
FBN1-2623H | Recombinant Human FBN1 protein, His & GST-tagged | +Inquiry |
FBN1-2624H | Recombinant Human FBN1 protein, His & GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBN1 Products
Required fields are marked with *
My Review for All FBN1 Products
Required fields are marked with *