Recombinant Human FBN2

Cat.No. : FBN2-28840TH
Product Overview : Recombinant fragment of Human Fibrillin 2 (amino acids 2776-2876) with proprietary tag at the N terminal; Predicted MW 36.74 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 101 amino acids
Description : The protein encoded by this gene is a component of connective tissue microfibrils and may be involved in elastic fiber assembly. Mutations in this gene cause congenital contractural arachnodactyly.
Molecular Weight : 36.740kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RQKRSIHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSK EHILELRPAIQPLNNHIRYVISQGNDDSVFRIHQRNGLSY LHTAKKKLMPGTYTLEITSIP
Sequence Similarities : Belongs to the fibrillin family.Contains 47 EGF-like domains.Contains 9 TB (TGF-beta binding) domains.
Gene Name FBN2 fibrillin 2 [ Homo sapiens ]
Official Symbol FBN2
Synonyms FBN2; fibrillin 2; CCA, congenital contractural arachnodactyly; fibrillin-2; DA9; fibrillin 5;
Gene ID 2201
mRNA Refseq NM_001999
Protein Refseq NP_001990
MIM 612570
Uniprot ID P35556
Chromosome Location 5q23-q31
Function binding; calcium ion binding; extracellular matrix structural constituent;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FBN2 Products

Required fields are marked with *

My Review for All FBN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon