Recombinant Human FBN2
Cat.No. : | FBN2-28840TH |
Product Overview : | Recombinant fragment of Human Fibrillin 2 (amino acids 2776-2876) with proprietary tag at the N terminal; Predicted MW 36.74 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 101 amino acids |
Description : | The protein encoded by this gene is a component of connective tissue microfibrils and may be involved in elastic fiber assembly. Mutations in this gene cause congenital contractural arachnodactyly. |
Molecular Weight : | 36.740kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RQKRSIHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSK EHILELRPAIQPLNNHIRYVISQGNDDSVFRIHQRNGLSY LHTAKKKLMPGTYTLEITSIP |
Sequence Similarities : | Belongs to the fibrillin family.Contains 47 EGF-like domains.Contains 9 TB (TGF-beta binding) domains. |
Gene Name | FBN2 fibrillin 2 [ Homo sapiens ] |
Official Symbol | FBN2 |
Synonyms | FBN2; fibrillin 2; CCA, congenital contractural arachnodactyly; fibrillin-2; DA9; fibrillin 5; |
Gene ID | 2201 |
mRNA Refseq | NM_001999 |
Protein Refseq | NP_001990 |
MIM | 612570 |
Uniprot ID | P35556 |
Chromosome Location | 5q23-q31 |
Function | binding; calcium ion binding; extracellular matrix structural constituent; |
◆ Recombinant Proteins | ||
FBN2-3013H | Recombinant Human FBN2 Protein (Thr1550-Cys1791), N-GST tagged | +Inquiry |
FBN2-12H | Recombinant Human FBN2 protein, His-tagged | +Inquiry |
FBN2-28840TH | Recombinant Human FBN2 | +Inquiry |
FBN2-5706M | Recombinant Mouse FBN2 Protein | +Inquiry |
FBN2-516H | Recombinant Human FBN2 Protein, His/GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBN2 Products
Required fields are marked with *
My Review for All FBN2 Products
Required fields are marked with *
0
Inquiry Basket