Recombinant Human FBP1 Protein, His-tagged
Cat.No. : | FBP1-788H |
Product Overview : | Recombinant Human FBP1, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis. |
Form : | Supplied as a 0.2 µM filtered solution of 20mM TrisHCl, 1mM DTT, 10% glycerol, pH 8.0 |
Molecular Mass : | 37.8kD |
AA Sequence : | ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQVDHHHHHH* |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | FBP1 fructose-1,6-bisphosphatase 1 [ Homo sapiens ] |
Official Symbol | FBP1 |
Synonyms | FBP1; fructose-1,6-bisphosphatase 1; FBP; FBPase 1; fructose-bisphosphatase 1; growth-inhibiting protein 17; D-fructose-1,6-bisphosphate 1-phosphohydrolase 1; |
Gene ID | 2203 |
mRNA Refseq | NM_000507 |
Protein Refseq | NP_000498 |
MIM | 611570 |
UniProt ID | P09467 |
◆ Recombinant Proteins | ||
FBP1-894H | Recombinant Human FBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBP1-2427H | Recombinant Human FBP1 Protein (Ala2-Gln338), C-His tagged | +Inquiry |
FBP1-863HFL | Recombinant Full Length Human FBP1 Protein, C-Flag-tagged | +Inquiry |
FBP1-5329C | Recombinant Chicken FBP1 | +Inquiry |
FBP1-2283R | Recombinant Rat FBP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBP1-6316HCL | Recombinant Human FBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBP1 Products
Required fields are marked with *
My Review for All FBP1 Products
Required fields are marked with *