Recombinant Human FBP1 Protein, His-tagged
| Cat.No. : | FBP1-788H |
| Product Overview : | Recombinant Human FBP1, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Description : | Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis. |
| Form : | Supplied as a 0.2 µM filtered solution of 20mM TrisHCl, 1mM DTT, 10% glycerol, pH 8.0 |
| Molecular Mass : | 37.8kD |
| AA Sequence : | ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQVDHHHHHH* |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | FBP1 fructose-1,6-bisphosphatase 1 [ Homo sapiens ] |
| Official Symbol | FBP1 |
| Synonyms | FBP1; fructose-1,6-bisphosphatase 1; FBP; FBPase 1; fructose-bisphosphatase 1; growth-inhibiting protein 17; D-fructose-1,6-bisphosphate 1-phosphohydrolase 1; |
| Gene ID | 2203 |
| mRNA Refseq | NM_000507 |
| Protein Refseq | NP_000498 |
| MIM | 611570 |
| UniProt ID | P09467 |
| ◆ Recombinant Proteins | ||
| FBP1-1651R | Recombinant Rhesus monkey FBP1 Protein, His-tagged | +Inquiry |
| FBP1-894H | Recombinant Human FBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FBP1-2427H | Recombinant Human FBP1 Protein (Ala2-Gln338), C-His tagged | +Inquiry |
| FBP1-5707M | Recombinant Mouse FBP1 Protein | +Inquiry |
| FBP1-1207H | Recombinant Human FBP1 Protein, His-SUMO/MYC-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBP1-6316HCL | Recombinant Human FBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBP1 Products
Required fields are marked with *
My Review for All FBP1 Products
Required fields are marked with *
