Recombinant Human FBP2 protein, His-tagged
Cat.No. : | FBP2-3027H |
Product Overview : | Recombinant Human FBP2 protein(283-339 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 283-339 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | NPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | FBP2 fructose-1,6-bisphosphatase 2 [ Homo sapiens ] |
Official Symbol | FBP2 |
Synonyms | FBP2; fructose-1,6-bisphosphatase 2; fructose-1,6-bisphosphatase isozyme 2; FBPase 2; hexosediphosphatase; muscle fructose-bisphosphatase; D-fructose-1,6-bisphosphate 1-phosphohydrolase 2; MGC142192; |
mRNA Refseq | NM_003837 |
Protein Refseq | NP_003828 |
MIM | 603027 |
UniProt ID | O00757 |
Gene ID | 8789 |
◆ Recombinant Proteins | ||
Fbp2-4945R | Recombinant Mouse Fbp2 protein | +Inquiry |
FBP2-5708M | Recombinant Mouse FBP2 Protein | +Inquiry |
FBP2-4897HF | Recombinant Full Length Human FBP2 Protein, GST-tagged | +Inquiry |
FBP2-2284R | Recombinant Rat FBP2 Protein | +Inquiry |
FBP2-369H | Recombinant Human fructose-1,6-bisphosphatase 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBP2-6315HCL | Recombinant Human FBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBP2 Products
Required fields are marked with *
My Review for All FBP2 Products
Required fields are marked with *