Recombinant Human FBXL12 Protein, GST-tagged
Cat.No. : | FBXL12-3887H |
Product Overview : | Human FBXL12 full-length ORF ( AAH01586, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Members of the F-box protein family, such as FBXL12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 61.6 kDa |
AA Sequence : | MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKESMDWWM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXL12 F-box and leucine-rich repeat protein 12 [ Homo sapiens ] |
Official Symbol | FBXL12 |
Synonyms | FBXL12; F-box and leucine-rich repeat protein 12; F-box/LRR-repeat protein 12; Fbl12; FLJ20188; F-box protein FBL12; |
Gene ID | 54850 |
mRNA Refseq | NM_017703 |
Protein Refseq | NP_060173 |
MIM | 609079 |
UniProt ID | Q9NXK8 |
◆ Recombinant Proteins | ||
FBXL12-4921HF | Recombinant Full Length Human FBXL12 Protein, GST-tagged | +Inquiry |
FBXL12-7033C | Recombinant Chicken FBXL12 | +Inquiry |
FBXL12-5711M | Recombinant Mouse FBXL12 Protein | +Inquiry |
FBXL12-3139M | Recombinant Mouse FBXL12 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXL12-3887H | Recombinant Human FBXL12 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXL12-6314HCL | Recombinant Human FBXL12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXL12 Products
Required fields are marked with *
My Review for All FBXL12 Products
Required fields are marked with *