Recombinant Human FBXL18 protein, His-SUMO-tagged
| Cat.No. : | FBXL18-2888H |
| Product Overview : | Recombinant Human FBXL18 protein(Q96ME1)(1-365aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-365aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 56.2 kDa |
| AA Sequence : | MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGSTVEHVARCRSLVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLSSECKATLSRVRELKQTLFTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQSNVPHYQNLRVFYARLAPGYINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKNLLDSMARNVVLDALQLPKSWLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGKDLRSLASLNLSGCVHCLSPDSLLCR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FBXL18 F-box and leucine-rich repeat protein 18 [ Homo sapiens ] |
| Official Symbol | FBXL18 |
| Synonyms | FBXL18; F-box and leucine-rich repeat protein 18; F-box/LRR-repeat protein 18; Fbl18; FLJ11467; FLJ10776; FLJ26934; FLJ38075; FLJ41541; |
| Gene ID | 80028 |
| mRNA Refseq | NM_024963 |
| Protein Refseq | NP_079239 |
| MIM | 609084 |
| UniProt ID | Q96ME1 |
| ◆ Recombinant Proteins | ||
| FBXL18-4956HF | Recombinant Full Length Human FBXL18 Protein, GST-tagged | +Inquiry |
| FBXL18-4159H | Recombinant Human FBXL18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Fbxl18-2961M | Recombinant Mouse Fbxl18 Protein, Myc/DDK-tagged | +Inquiry |
| FBXL18-2888H | Recombinant Human FBXL18 protein, His-SUMO-tagged | +Inquiry |
| FBXL18-3329Z | Recombinant Zebrafish FBXL18 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBXL18-599HCL | Recombinant Human FBXL18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXL18 Products
Required fields are marked with *
My Review for All FBXL18 Products
Required fields are marked with *
