Recombinant Human FBXO11 protein, His-tagged

Cat.No. : FBXO11-2749H
Product Overview : Recombinant Human FBXO11 protein(858-927 aa), fused to His tag, was expressed in E. coli.
Availability January 13, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 858-927 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : TDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name FBXO11 F-box protein 11 [ Homo sapiens ]
Official Symbol FBXO11
Synonyms FBXO11; F-box protein 11; F box only protein 11; F-box only protein 11; FBX11; PRMT9; ubiquitin protein ligase E3 component n recognin 6; UBR6; vitiligo-associated protein 1; vitiligo-associated protein VIT-1; protein arginine N-methyltransferase 9; ubiquitin protein ligase E3 component n-recognin 6; VIT1; UG063H01; FLJ12673; MGC44383;
Gene ID 80204
mRNA Refseq NM_001190274
Protein Refseq NP_001177203
MIM 607871
UniProt ID Q86XK2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBXO11 Products

Required fields are marked with *

My Review for All FBXO11 Products

Required fields are marked with *

0
cart-icon
0
compare icon