Recombinant Human FBXO11 protein, His-tagged
| Cat.No. : | FBXO11-2749H |
| Product Overview : | Recombinant Human FBXO11 protein(858-927 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 13, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 858-927 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | TDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FBXO11 F-box protein 11 [ Homo sapiens ] |
| Official Symbol | FBXO11 |
| Synonyms | FBXO11; F-box protein 11; F box only protein 11; F-box only protein 11; FBX11; PRMT9; ubiquitin protein ligase E3 component n recognin 6; UBR6; vitiligo-associated protein 1; vitiligo-associated protein VIT-1; protein arginine N-methyltransferase 9; ubiquitin protein ligase E3 component n-recognin 6; VIT1; UG063H01; FLJ12673; MGC44383; |
| Gene ID | 80204 |
| mRNA Refseq | NM_001190274 |
| Protein Refseq | NP_001177203 |
| MIM | 607871 |
| UniProt ID | Q86XK2 |
| ◆ Recombinant Proteins | ||
| FBXO11-2749H | Recombinant Human FBXO11 protein, His-tagged | +Inquiry |
| FBXO11-2288R | Recombinant Rat FBXO11 Protein | +Inquiry |
| FBXO11-1657R | Recombinant Rhesus monkey FBXO11 Protein, His-tagged | +Inquiry |
| FBXO11-3914H | Recombinant Human FBXO11 Protein, GST-tagged | +Inquiry |
| FBXO11-1481R | Recombinant Rhesus Macaque FBXO11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBXO11-6309HCL | Recombinant Human FBXO11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO11 Products
Required fields are marked with *
My Review for All FBXO11 Products
Required fields are marked with *
