Recombinant Human FBXO24 Protein, GST-tagged
Cat.No. : | FBXO24-3922H |
Product Overview : | Human FBXO24 full-length ORF ( NP_277041.1, 1 a.a. - 580 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2009] |
Molecular Mass : | 91.3 kDa |
AA Sequence : | MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPWKRAAILNYTKGLYFQAFGGRRRCLSKSVAPLLAHGYRRFLPTKDHVFILDYVGTLFFLKNALVSTLGQMQWKRACRYVVLCRGAKDFASDPRCDTVYRKYLYVLATREPQEVVGTTSSRACDCVEVYLQSSGQRVFKMTFHHSMTFKQIVLVGQETQRALLLLTEEGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLYVTDQGGVYFEVHTPGVYRDLFGTLQAFDPLDQQMPLALSLPAKILFCALGYNHLGLVDEFGRIFMQGNNRYGQLGTGDKMDRGEPTQVCYLQRPITLWCGLNHSLVLSQSSEFSKELLGCGCGAGGRLPGWPKGSASFVKLQVKVPLCACALCATRECLYILSSHDIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMAQACEEYLSQIHSCQTLQDRTEKMKEIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPET |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXO24 F-box protein 24 [ Homo sapiens ] |
Official Symbol | FBXO24 |
Synonyms | FBXO24; F-box protein 24; F box only protein 24; F-box only protein 24; FBX24; F-box protein Fbx24; DKFZp434I1122; |
Gene ID | 26261 |
mRNA Refseq | NM_001163499 |
Protein Refseq | NP_001156971 |
MIM | 609097 |
UniProt ID | O75426 |
◆ Recombinant Proteins | ||
FBXO24-5027HF | Recombinant Full Length Human FBXO24 Protein, GST-tagged | +Inquiry |
FBXO24-3922H | Recombinant Human FBXO24 Protein, GST-tagged | +Inquiry |
FBXO24-516C | Recombinant Cynomolgus FBXO24 Protein, His-tagged | +Inquiry |
FBXO24-261C | Recombinant Cynomolgus Monkey FBXO24 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO24-5737M | Recombinant Mouse FBXO24 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO24 Products
Required fields are marked with *
My Review for All FBXO24 Products
Required fields are marked with *