Recombinant Human FBXO7 Protein, GST-tagged
Cat.No. : | FBXO7-3960H |
Product Overview : | Human FBXO7 full-length ORF ( AAH08361.1, 1 a.a. - 522 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it may play a role in regulation of hematopoiesis. Alternatively spliced transcript variants of this gene have been identified with the full-length natures of only some variants being determined. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 84.9 kDa |
AA Sequence : | MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSIQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXO7 F-box protein 7 [ Homo sapiens ] |
Official Symbol | FBXO7 |
Synonyms | FBXO7; F-box protein 7; F box only protein 7; F-box only protein 7; Fbx; FBX7; PARK15; FBX; PKPS; FBX07; DKFZp686B08113; |
Gene ID | 25793 |
mRNA Refseq | NM_001033024 |
Protein Refseq | NP_001028196 |
MIM | 605648 |
UniProt ID | Q9Y3I1 |
◆ Recombinant Proteins | ||
FBXO7-3175M | Recombinant Mouse FBXO7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO7-1957R | Recombinant Rat FBXO7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO7-1491R | Recombinant Rhesus Macaque FBXO7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO7-3960H | Recombinant Human FBXO7 Protein, GST-tagged | +Inquiry |
FBXO7-2300R | Recombinant Rat FBXO7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO7-608HCL | Recombinant Human FBXO7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO7 Products
Required fields are marked with *
My Review for All FBXO7 Products
Required fields are marked with *