Recombinant Human FCAMR Protein, GST-tagged
Cat.No. : | FCAMR-3980H |
Product Overview : | Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FCAMR (Fc Fragment Of IgA And IgM Receptor) is a Protein Coding gene. Among its related pathways are Cell surface interactions at the vascular wall and CD40/CD40L signaling. GO annotations related to this gene include transmembrane signaling receptor activity and IgM binding. An important paralog of this gene is PIGR. |
Molecular Mass : | 37.62 kDa |
AA Sequence : | TLRPSSPLCWREESSFAAPNSLKGSRLVSGEPGGAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNQYTHHRYRDRVALTDFPQRGLFVVRLSQLSPDDIGC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCAMR Fc fragment of IgA and IgM receptor [ Homo sapiens (human) ] |
Official Symbol | FCAMR |
Synonyms | FCAMR; Fc fragment of IgA and IgM receptor; Fc Fragment Of IgA And IgM Receptor; Fc Receptor, IgA, IgM, High Affinity; Fc Alpha/Mu Receptor; High Affinity Immunoglobulin Alpha And Immunoglobulin Mu Fc Receptor; Receptor For Fc Fragment Of IgA And IgM; Immunity Related Factor; CD351 Antigen; FCA/MR; FKSG87; CD351; high affinity immunoglobulin alpha and immunoglobulin mu Fc receptor; Fc alpha/mu receptor; Fc receptor, IgA, IgM, high affinity; immunity related factor; receptor for Fc fragment of IgA and IgM |
Gene ID | 83953 |
mRNA Refseq | NM_001122979 |
Protein Refseq | NP_001116451 |
MIM | 605484 |
UniProt ID | Q8WWV6 |
◆ Recombinant Proteins | ||
FCAMR-279H | Active Recombinant Human FCAMR protein, His-tagged | +Inquiry |
FCAMR-5783M | Recombinant Mouse FCAMR Protein | +Inquiry |
FCAMR-235H | Recombinant Human FCAMR Protein, C-His-tagged | +Inquiry |
FCAMR-1771R | Recombinant Rhesus Monkey FCAMR Protein, hIgG1-tagged | +Inquiry |
FCAMR-1772R | Recombinant Rhesus Monkey FCAMR Protein, hIgG4-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCAMR Products
Required fields are marked with *
My Review for All FCAMR Products
Required fields are marked with *