Recombinant Human FCAR Protein, His-tagged
Cat.No. : | FCAR-030H |
Product Overview : | Recombinant Human FCAR Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Fc (Ig constant fragment) receptors ensure protection of the host against foreign antigens, such as microorganisms and pathogens, by removing Ig-coated antigen complexes from circulation. Fc receptors are present on lymphoid and myeloid derivatives, where they mediate endocytosis of Ig-antigen complexes, antibody production in B cells through T cell antigen presentation, cytotoxicity and the release of cytokines and reactive oxygen species. CD89, also known as Immunoglobulin α Fc receptor (Fc α RI), is a glycoprotein that is expressed on the surface of neutrophils, monocytes, macrophages and eosinophils and is a potent cytotoxic trigger molecule. CD89 specifically interacts with aggregated IgAs, not IgG. Cytokines can initiate a high-binding state for CD89 through a mechanism that involves the intracellular C-terminus of CD89. Polymorphisms within the gene encoding CD89 may be associated with susceptibility to IgA nephropathy, a form of glomerulonephritis characterized by IgA antibody deposition in the kidney glomerulus. |
Molecular Mass : | ~23 kDa |
AA Sequence : | QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | FCAR Fc fragment of IgA, receptor for [ Homo sapiens (human) ] |
Official Symbol | FCAR |
Synonyms | FCAR; Fc fragment of IgA, receptor for; immunoglobulin alpha Fc receptor; CD89; IgA Fc receptor; Fc alpha receptor; |
Gene ID | 2204 |
mRNA Refseq | NM_002000 |
Protein Refseq | NP_001991 |
MIM | 147045 |
UniProt ID | P24071 |
◆ Recombinant Proteins | ||
FCAR-3634H | Recombinant Human FCAR protein, His-tagged | +Inquiry |
FCAR-151H | Recombinant Human FCAR Protein, His-tagged | +Inquiry |
FCAR-2644H | Recombinant Human FCAR protein, hFc&His-tagged | +Inquiry |
RFL17HF | Recombinant Full Length Human Immunoglobulin Alpha Fc Receptor(Fcar) Protein, His-Tagged | +Inquiry |
Fcar-4080R | Recombinant Rat Fcar protein(Met1-Asn228), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCAR-3040HCL | Recombinant Human FCAR cell lysate | +Inquiry |
FCAR-1929RCL | Recombinant Rat FCAR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCAR Products
Required fields are marked with *
My Review for All FCAR Products
Required fields are marked with *
0
Inquiry Basket