Recombinant Human FCAR Protein, His-tagged
| Cat.No. : | FCAR-030H |
| Product Overview : | Recombinant Human FCAR Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Fc (Ig constant fragment) receptors ensure protection of the host against foreign antigens, such as microorganisms and pathogens, by removing Ig-coated antigen complexes from circulation. Fc receptors are present on lymphoid and myeloid derivatives, where they mediate endocytosis of Ig-antigen complexes, antibody production in B cells through T cell antigen presentation, cytotoxicity and the release of cytokines and reactive oxygen species. CD89, also known as Immunoglobulin α Fc receptor (Fc α RI), is a glycoprotein that is expressed on the surface of neutrophils, monocytes, macrophages and eosinophils and is a potent cytotoxic trigger molecule. CD89 specifically interacts with aggregated IgAs, not IgG. Cytokines can initiate a high-binding state for CD89 through a mechanism that involves the intracellular C-terminus of CD89. Polymorphisms within the gene encoding CD89 may be associated with susceptibility to IgA nephropathy, a form of glomerulonephritis characterized by IgA antibody deposition in the kidney glomerulus. |
| Molecular Mass : | ~23 kDa |
| AA Sequence : | QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | FCAR Fc fragment of IgA, receptor for [ Homo sapiens (human) ] |
| Official Symbol | FCAR |
| Synonyms | FCAR; Fc fragment of IgA, receptor for; immunoglobulin alpha Fc receptor; CD89; IgA Fc receptor; Fc alpha receptor; |
| Gene ID | 2204 |
| mRNA Refseq | NM_002000 |
| Protein Refseq | NP_001991 |
| MIM | 147045 |
| UniProt ID | P24071 |
| ◆ Recombinant Proteins | ||
| FCAR-151H | Recombinant Human FCAR Protein, His-tagged | +Inquiry |
| FCAR-3014H | Recombinant Human FCAR Protein (Gln22-Asn227), C-His-Fc tagged | +Inquiry |
| Fcar-6910R | Recombinant Rat Fcar protein, His & T7-tagged | +Inquiry |
| FCAR-030H | Recombinant Human FCAR Protein, His-tagged | +Inquiry |
| FCAR-459H | Active Recombinant Human FCAR Protein, hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCAR-3040HCL | Recombinant Human FCAR cell lysate | +Inquiry |
| FCAR-1929RCL | Recombinant Rat FCAR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCAR Products
Required fields are marked with *
My Review for All FCAR Products
Required fields are marked with *
