Recombinant Human FCER2 Protein
Cat.No. : | FCER2-539H |
Product Overview : | Recombinant human FCER2 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 321 |
Description : | The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Form : | Lyophilized |
AA Sequence : | MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | FCER2 Fc fragment of IgE, low affinity II, receptor for (CD23) [ Homo sapiens (human) ] |
Official Symbol | FCER2 |
Synonyms | FCER2; Fc fragment of IgE, low affinity II, receptor for (CD23); CD23A, Fc fragment of IgE, low affinity II, receptor for (CD23A) , FCE2; low affinity immunoglobulin epsilon Fc receptor; CD23; CLEC4J; BLAST-2; CD23 antigen; fc-epsilon-RII; lymphocyte IgE receptor; immunoglobulin E-binding factor; C-type lectin domain family 4, member J; FCE2; CD23A; IGEBF; |
Gene ID | 2208 |
mRNA Refseq | NM_001207019 |
Protein Refseq | NP_001193948 |
MIM | 151445 |
UniProt ID | P06734 |
◆ Recombinant Proteins | ||
FCER2-27296TH | Recombinant Human FCER2 protein(48-248aa), GST-tagged | +Inquiry |
FCER2-031H | Recombinant Human FCER2 Protein, His-tagged | +Inquiry |
FCER2-922H | Recombinant Human FCER2 Protein, His-tagged | +Inquiry |
FCER2-3811H | Recombinant Human FCER2 protein(48-248aa), His-tagged | +Inquiry |
FCER2-343R | Recombinant Rat FCER2 protein(Glu50-Pro331), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER2-1023RCL | Recombinant Rat FCER2 cell lysate | +Inquiry |
FCER2-1814HCL | Recombinant Human FCER2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCER2 Products
Required fields are marked with *
My Review for All FCER2 Products
Required fields are marked with *
0
Inquiry Basket