Recombinant Human FCER2 protein
Cat.No. : | FCER2-27253TH |
Product Overview : | Recombinant Human FCER2 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 172 |
Description : | The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 determined by its ability to induce TNF-alpha production by human PBMCs. |
Molecular Mass : | Approximately 19.2 kDa, a single non-glycosylated polypeptide chain containing 172 amino acids. |
AA Sequence : | MELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
Endotoxin : | Less than 0.1 EU/µg of rHusCD23 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | FCER2 |
Official Symbol | FCER2 |
Synonyms | FCER2; Fc fragment of IgE, low affinity II, receptor for (CD23); CD23A, Fc fragment of IgE, low affinity II, receptor for (CD23A) , FCE2; low affinity immunoglobulin epsilon Fc receptor; CD23; CLEC4J; BLAST-2; CD23 antigen; fc-epsilon-RII; lymphocyte IgE receptor; immunoglobulin E-binding factor; C-type lectin domain family 4, member J; FCE2; CD23A; IGEBF; |
Gene ID | 2208 |
mRNA Refseq | NM_001207019 |
Protein Refseq | NP_001193948 |
MIM | 151445 |
UniProt ID | P06734 |
◆ Recombinant Proteins | ||
FCER2-3985H | Recombinant Human FCER2 Protein, GST-tagged | +Inquiry |
FCER2-4979H | Recombinant Human Fc Fragment Of IgE, Low Affinity II, Receptor For (CD23) | +Inquiry |
FCER2-27253TH | Recombinant Human FCER2 protein | +Inquiry |
FCER2-343RAF647 | Recombinant Rat Fcer2 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
FCER2-3984H | Recombinant Human FCER2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER2-1023RCL | Recombinant Rat FCER2 cell lysate | +Inquiry |
FCER2-1814HCL | Recombinant Human FCER2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCER2 Products
Required fields are marked with *
My Review for All FCER2 Products
Required fields are marked with *
0
Inquiry Basket