Recombinant Human FCER2 protein, His-SUMO-tagged
| Cat.No. : | FCER2-2892H |
| Product Overview : | Recombinant Human FCER2 protein(P06734)(48-321aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 48-321aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47 kDa |
| AA Sequence : | DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FCER2 Fc fragment of IgE, low affinity II, receptor for (CD23) [ Homo sapiens ] |
| Official Symbol | FCER2 |
| Synonyms | FCER2; Fc fragment of IgE, low affinity II, receptor for (CD23); CD23A, Fc fragment of IgE, low affinity II, receptor for (CD23A) , FCE2; low affinity immunoglobulin epsilon Fc receptor; CD23; CLEC4J; BLAST-2; CD23 antigen; fc-epsilon-RII; lymphocyte IgE receptor; immunoglobulin E-binding factor; C-type lectin domain family 4, member J; FCE2; CD23A; IGEBF; |
| Gene ID | 2208 |
| mRNA Refseq | NM_001207019 |
| Protein Refseq | NP_001193948 |
| MIM | 151445 |
| UniProt ID | P06734 |
| ◆ Recombinant Proteins | ||
| FCER2-27253TH | Recombinant Human FCER2 protein | +Inquiry |
| FCER2-3985H | Recombinant Human FCER2 Protein, GST-tagged | +Inquiry |
| FCER2-539H | Recombinant Human FCER2 Protein | +Inquiry |
| FCER2-27296TH | Recombinant Human FCER2 protein(48-248aa), GST-tagged | +Inquiry |
| FCER2-343RAF488 | Recombinant Rat Fcer2 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCER2-1814HCL | Recombinant Human FCER2 cell lysate | +Inquiry |
| FCER2-1023RCL | Recombinant Rat FCER2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER2 Products
Required fields are marked with *
My Review for All FCER2 Products
Required fields are marked with *
