Recombinant Human FCGR2B Protein, His-tagged
| Cat.No. : | FCGR2B-403H |
| Product Overview : | Recombinant Human FCGR2B, transcript variant 4, fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Description : | The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. |
| Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Molecular Mass : | 20.64kD |
| AA Sequence : | TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPVDHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | FCGR2B Fc fragment of IgG, low affinity IIb, receptor (CD32) [ Homo sapiens ] |
| Official Symbol | FCGR2B |
| Synonyms | FCGR2B; Fc fragment of IgG, low affinity IIb, receptor (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32) , FCG2, FCGR2; low affinity immunoglobulin gamma Fc region receptor II-b; CD32; CD32B; CDw32; fcRII-b; Fc gamma RIIb; fc-gamma-RIIb; fc-gamma RII-b; igG Fc receptor II-b; Fc fragment of IgG, low affinity II, receptor for (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32); FCG2; FCGR2; IGFR2; |
| Gene ID | 2213 |
| mRNA Refseq | NM_001002273 |
| Protein Refseq | NP_001002273 |
| MIM | 604590 |
| UniProt ID | P31994 |
| ◆ Recombinant Proteins | ||
| FCGR2B-1800H | Recombinant Human FCGR2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FCGR2B-1676R | Recombinant Rhesus monkey FCGR2B Protein, His-tagged | +Inquiry |
| Fcgr2b-3995M | Recombinant Mouse Fcgr2b, His & AVI tagged | +Inquiry |
| FCGR2B-4543C | Active Recombinant Cynomolgus FCGR2B protein(Met1-Pro217), His-tagged | +Inquiry |
| FCGR2B-291C | Active Recombinant Cynomolgus FCGR2B protein, His/Avi-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCGR2B-001HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
| FCGR2B-1994CCL | Recombinant Cynomolgus FCGR2B cell lysate | +Inquiry |
| FCGR2B-1942RCL | Recombinant Rat FCGR2B cell lysate | +Inquiry |
| FCGR2B-1988HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR2B Products
Required fields are marked with *
My Review for All FCGR2B Products
Required fields are marked with *
