Recombinant Human FCGR2B Protein, His-tagged
Cat.No. : | FCGR2B-403H |
Product Overview : | Recombinant Human FCGR2B, transcript variant 4, fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Molecular Mass : | 20.64kD |
AA Sequence : | TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | FCGR2B Fc fragment of IgG, low affinity IIb, receptor (CD32) [ Homo sapiens ] |
Official Symbol | FCGR2B |
Synonyms | FCGR2B; Fc fragment of IgG, low affinity IIb, receptor (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32) , FCG2, FCGR2; low affinity immunoglobulin gamma Fc region receptor II-b; CD32; CD32B; CDw32; fcRII-b; Fc gamma RIIb; fc-gamma-RIIb; fc-gamma RII-b; igG Fc receptor II-b; Fc fragment of IgG, low affinity II, receptor for (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32); FCG2; FCGR2; IGFR2; |
Gene ID | 2213 |
mRNA Refseq | NM_001002273 |
Protein Refseq | NP_001002273 |
MIM | 604590 |
UniProt ID | P31994 |
◆ Recombinant Proteins | ||
FCGR2B-1800H | Recombinant Human FCGR2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FCGR2B-545H | Recombinant Human FCGR2B Protein | +Inquiry |
FCGR2B-291C | Active Recombinant Cynomolgus FCGR2B protein, His/Avi-tagged, Biotinylated | +Inquiry |
FCGR2B-650H | Active Recombinant Human FCGR2B Protein, His-tagged | +Inquiry |
Fcgr2b-2968M | Active Recombinant Mouse Fcgr2b protein(Met1-Arg217), His&Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR2B-1994CCL | Recombinant Cynomolgus FCGR2B cell lysate | +Inquiry |
FCGR2B-001HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
FCGR2B-1942RCL | Recombinant Rat FCGR2B cell lysate | +Inquiry |
FCGR2B-1988HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCGR2B Products
Required fields are marked with *
My Review for All FCGR2B Products
Required fields are marked with *
0
Inquiry Basket