Recombinant Human FCGR3A protein, His&Myc-tagged

• Cat.No.: FCGR3A-5743H
• Product Overview: Recombinant Human FCGR3A protein(P08637)(49-184aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 49-184aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 50.7 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSE

Gene Information

• Gene Name: FCGR3A Fc fragment of IgG, low affinity IIIa, receptor (CD16a) [ Homo sapiens ]
• Official Symbol: FCGR3A
• Synonyms: FCGR3A; Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc fragment of IgG, low affinity IIIa, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-A; CD16; CD16a; FcgammaRIIIA; CD16a antigen; fc-gamma RIII; Fc-gamma RIIIa; Fc-gamma RIII-alpha; igG Fc receptor III-2; Fc gamma receptor III-A; Fc-gamma receptor IIIb (CD16); neutrophil-specific antigen NA; Fc-gamma receptor III-2 (CD 16); immunoglobulin G Fc receptor III; Fc fragment of IgG, low affinity III, receptor for (CD16); FCG3; CD16A; FCGR3; IGFR3; FCR-10; FCRIII; FCGRIII; FCRIIIA
• Gene ID: 2214
• mRNA Refseq: NM_000569
• Protein Refseq: NP_000560
• MIM: 146740
• UniProt ID: P08637