Recombinant Human FCGR3A protein, His&Myc-tagged

Cat.No. : FCGR3A-5743H
Product Overview : Recombinant Human FCGR3A protein(P08637)(49-184aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 49-184aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 50.7 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSE
Gene Name FCGR3A Fc fragment of IgG, low affinity IIIa, receptor (CD16a) [ Homo sapiens ]
Official Symbol FCGR3A
Synonyms FCGR3A; Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc fragment of IgG, low affinity IIIa, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-A; CD16; CD16a; FcgammaRIIIA; CD16a antigen; fc-gamma RIII; Fc-gamma RIIIa; Fc-gamma RIII-alpha; igG Fc receptor III-2; Fc gamma receptor III-A; Fc-gamma receptor IIIb (CD16); neutrophil-specific antigen NA; Fc-gamma receptor III-2 (CD 16); immunoglobulin G Fc receptor III; Fc fragment of IgG, low affinity III, receptor for (CD16); FCG3; CD16A; FCGR3; IGFR3; FCR-10; FCRIII; FCGRIII; FCRIIIA;
Gene ID 2214
mRNA Refseq NM_000569
Protein Refseq NP_000560
MIM 146740
UniProt ID P08637

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCGR3A Products

Required fields are marked with *

My Review for All FCGR3A Products

Required fields are marked with *

0
cart-icon
0
compare icon