Recombinant Human FCGR3B protein(21-100 aa), C-His-tagged
Cat.No. : | FCGR3B-2478H |
Product Overview : | Recombinant Human FCGR3B protein(O75015)(21-100 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-100 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPV |
Gene Name | FCGR3B Fc fragment of IgG, low affinity IIIb, receptor (CD16b) [ Homo sapiens ] |
Official Symbol | FCGR3B |
Synonyms | FCGR3B; Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc fragment of IgG, low affinity IIIb, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-B; CD16; CD16b; fc-gamma RIII; fc-gamma RIIIb; fc-gamma RIII-beta; igG Fc receptor III-1; Fc-gamma receptor IIIb (CD 16); Fc fragment of IgG, low affinity IIIb, receptor for (CD16); FCG3; FCGR3; FCR-10; FCRIII; FCRIIIb; |
Gene ID | 2215 |
mRNA Refseq | NM_000570 |
Protein Refseq | NP_000561 |
MIM | 610665 |
UniProt ID | O75015 |
◆ Recombinant Proteins | ||
FCGR3B-484H | Active Recombinant Human FCGR3B Protein (Met18-Gly193), Biotinylated | +Inquiry |
FCGR3B-315H | Recombinant Human FCGR3B protein (Met 1-Ser 200 (Ala 78 Asp)), SH allotype, His-tagged | +Inquiry |
FCGR3B-549H | Recombinant Human FCGR3B Protein, His-tagged | +Inquiry |
FCGR3B-1209H | Recombinant Human FCGR3B Protein (Gly17-Ser200), N-His tagged | +Inquiry |
FCGR3B-1473H | Recombinant Human FCGR3B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR3B-3055HCL | Recombinant Human FCGR3B cell lysate | +Inquiry |
FCGR3B-001HCL | Recombinant Human FCGR3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR3B Products
Required fields are marked with *
My Review for All FCGR3B Products
Required fields are marked with *