Recombinant Human FCGR3B Protein

Cat.No. : FCGR3B-550H
Product Overview : Recombinant human FCGR3B protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Protein Length : 233
Description : The protein encoded by this gene is a low affinity receptor for the Fc region of gamma immunoglobulins (IgG). The encoded protein acts as a monomer and can bind either monomeric or aggregated IgG. This gene may function to capture immune complexes in the peripheral circulation. Several transcript variants encoding different isoforms have been found for this gene. A highly-similar gene encoding a related protein is also found on chromosome 1.
Form : Lyophilized
AA Sequence : MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name FCGR3B Fc fragment of IgG, low affinity IIIb, receptor (CD16b) [ Homo sapiens (human) ]
Official Symbol FCGR3B
Synonyms FCGR3B; Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc fragment of IgG, low affinity IIIb, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-B; CD16; CD16b; fc-gamma RIII; fc-gamma RIIIb; fc-gamma RIII-beta; igG Fc receptor III-1; Fc-gamma receptor IIIb (CD 16); Fc fragment of IgG, low affinity IIIb, receptor for (CD16); FCG3; FCGR3; FCR-10; FCRIII; FCRIIIb;
Gene ID 2215
mRNA Refseq NM_000570
Protein Refseq NP_000561
MIM 610665
UniProt ID O75015

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCGR3B Products

Required fields are marked with *

My Review for All FCGR3B Products

Required fields are marked with *

0
cart-icon