Recombinant Human FCGRT Protein, GST-tagged
| Cat.No. : | FCGRT-1210H |
| Product Overview : | Recombinant Human FCGRT Protein(24-297aa) was expressed in E. coli with N-terminal GST-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 24-297 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 57.4 kDa |
| AA Sequence : | AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | FCGRT Fc fragment of IgG, receptor, transporter, alpha [ Homo sapiens ] |
| Official Symbol | FCGRT |
| Synonyms | FCGRT; Fc fragment of IgG, receptor, transporter, alpha; IgG receptor FcRn large subunit p51; alpha chain; FCRN; FcRn alpha chain; neonatal Fc receptor; neonatal Fc-receptor for Ig; IgG Fc fragment receptor transporter alpha chain; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; alpha-chain |
| Gene ID | 2217 |
| mRNA Refseq | NM_001136019 |
| Protein Refseq | NP_001129491 |
| MIM | 601437 |
| UniProt ID | P55899 |
| ◆ Recombinant Proteins | ||
| FCGRT-3190M | Recombinant Mouse FCGRT Protein, His (Fc)-Avi-tagged | +Inquiry |
| FCGRT-5402H | Recombinant Human FCGRT protein, His-tagged | +Inquiry |
| Fcgrt-490MB | Recombinant Mouse Fcgrt protein, His-tagged, Biotinylated | +Inquiry |
| FCGRT-5255H | Recombinant Human FCGRT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Fcgrt-5665M | Recombinant Mouse Fcgrt Protein (Ser22-Val301, Ile21-Met119), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCGRT-6278HCL | Recombinant Human FCGRT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGRT Products
Required fields are marked with *
My Review for All FCGRT Products
Required fields are marked with *
