Recombinant Human FCGRT Protein, GST-tagged

Cat.No. : FCGRT-1210H
Product Overview : Recombinant Human FCGRT Protein(24-297aa) was expressed in E. coli with N-terminal GST-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 24-297 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 57.4 kDa
AA Sequence : AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name FCGRT Fc fragment of IgG, receptor, transporter, alpha [ Homo sapiens ]
Official Symbol FCGRT
Synonyms FCGRT; Fc fragment of IgG, receptor, transporter, alpha; IgG receptor FcRn large subunit p51; alpha chain; FCRN; FcRn alpha chain; neonatal Fc receptor; neonatal Fc-receptor for Ig; IgG Fc fragment receptor transporter alpha chain; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; alpha-chain
Gene ID 2217
mRNA Refseq NM_001136019
Protein Refseq NP_001129491
MIM 601437
UniProt ID P55899

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCGRT Products

Required fields are marked with *

My Review for All FCGRT Products

Required fields are marked with *

0
cart-icon