"FCRL3" Related Products

Expand
Expand

Recombinant Human FCRL3 Protein, GST-tagged

Cat.No. : FCRL3-4009H
Product Overview : Human FCRL3 partial ORF ( NP_001019838, 625 a.a. - 723 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain and may play a role in regulation of the immune system. Mutations in this gene have been associated with rheumatoid arthritis, autoimmune thyroid disease, and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.63 kDa
AA Sequence : SRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEENYE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : FCRL3 Fc receptor-like 3 [ Homo sapiens ]
Official Symbol : FCRL3
Synonyms : FCRL3; Fc receptor-like 3; Fc receptor-like protein 3; CD307c; FCRH3; IFGP3; IRTA3; SPAP2; SPAP2a; SPAP2b; SPAP2c; SPAP2d; SPAP2e; hIFGP3; fcR-like protein 3; Fc receptor homolog 3; IFGP family protein 3; SH2 domain-containing phosphatase anchor protein 2; immune receptor translocation-associated protein 3; immunoglobulin superfamily receptor translocation associated protein 3;
Gene ID : 115352
mRNA Refseq : NM_052939
Protein Refseq : NP_443171
MIM : 606510
UniProt ID : Q96P31

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.