Recombinant Human FFAR3 protein(280-346aa), His-GST-tagged

• Cat.No.: FFAR3-643H
• Product Overview: Recombinant Human FFAR3 protein(O14843)(280-346aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 280-346aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES

Gene Information

• Gene Name: FFAR3 free fatty acid receptor 3 [ Homo sapiens ]
• Official Symbol: FFAR3
• Synonyms: FFAR3; free fatty acid receptor 3; G protein coupled receptor 41 , GPR41; FFA3R; G protein-coupled receptor 41; G-protein coupled receptor 41; GPR41
• Gene ID: 2865
• mRNA Refseq: NM_005304
• Protein Refseq: NP_005295
• MIM: 603821
• UniProt ID: O14843