Recombinant Human FFAR3 protein(280-346aa), His-GST-tagged
Cat.No. : | FFAR3-643H |
Product Overview : | Recombinant Human FFAR3 protein(O14843)(280-346aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 280-346aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES |
Gene Name | FFAR3 free fatty acid receptor 3 [ Homo sapiens ] |
Official Symbol | FFAR3 |
Synonyms | FFAR3; free fatty acid receptor 3; G protein coupled receptor 41 , GPR41; FFA3R; G protein-coupled receptor 41; G-protein coupled receptor 41; GPR41; |
Gene ID | 2865 |
mRNA Refseq | NM_005304 |
Protein Refseq | NP_005295 |
MIM | 603821 |
UniProt ID | O14843 |
◆ Recombinant Proteins | ||
FFAR3-4801HF | Recombinant Full Length Human FFAR3 Protein | +Inquiry |
FFAR3-1977R | Recombinant Rat FFAR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21704MF | Recombinant Full Length Mouse Free Fatty Acid Receptor 3(Ffar3) Protein, His-Tagged | +Inquiry |
FFAR3-2320R | Recombinant Rat FFAR3 Protein | +Inquiry |
FFAR3-4086H | Recombinant Human FFAR3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FFAR3 Products
Required fields are marked with *
My Review for All FFAR3 Products
Required fields are marked with *