Recombinant Human FGF2 Protein, GMP Grade, Animal-Free
Cat.No. : | FGF2-28HG |
Product Overview : | GMP Recombinant Human FGF2 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | FGF-basic (154 a.a.) is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. |
AA Sequence : | AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Purity : | ≥ 95% by SDS-PAGE gel and HPLC analyses. |
Gene Name | FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens (human) ] |
Official Symbol | FGF2 |
Synonyms | FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2; |
Gene ID | 2247 |
mRNA Refseq | NM_002006 |
Protein Refseq | NP_001997 |
MIM | 134920 |
UniProt ID | P09038 |
◆ Recombinant Proteins | ||
FGF2-754H | Active Recombinant Human FGF2 protein | +Inquiry |
FGF2-22H | Recombinant Human FGF2 protein, GST-tagged | +Inquiry |
Fgf2-061M | Active Recombinant Mouse Fgf2 Protein | +Inquiry |
FGF2-14H | Active Recombinant Human FGF2 Protein | +Inquiry |
FGF2-730H | Active Recombinant Human FGF2, Ala-tagged | +Inquiry |
◆ Native Proteins | ||
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *