Recombinant Human FGF2 protein, GST-tagged
Cat.No. : | FGF2-22H |
Product Overview : | Recombinant Human FGF2(189 a.a. - 288 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 189-288 a.a. |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRT GQYKLGSKTGPGQKAILFLPMSAKS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens ] |
Official Symbol | FGF2 |
Synonyms | FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2; |
Gene ID | 2247 |
mRNA Refseq | NM_002006 |
Protein Refseq | NP_001997 |
MIM | 134920 |
UniProt ID | P09038 |
Chromosome Location | 4q26 |
Pathway | Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR1 ligand binding and activation, organism-specific biosystem; FGFR1b ligand binding and activation, organism-specific biosystem; FGFR1c ligand binding and activation, organism-specific biosystem; |
Function | chemoattractant activity; cytokine activity; fibroblast growth factor binding; fibroblast growth factor receptor binding; growth factor activity; heparin binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; protein tyrosine kinase activity; voltage-gated calcium channel activity; |
◆ Native Proteins | ||
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
FGF2-066D | Recombinant Duck FGF Basic Protein, Tag Free | +Inquiry |
FGF2-065C | Recombinant Chicken FGF Basic Protein, Tag Free | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *