Recombinant Human FGF2 protein, His-SUMO-tagged
| Cat.No. : | FGF2-2910H |
| Product Overview : | Recombinant Human FGF2 protein(P09038)(143-288aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 143-288aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.4 kDa |
| AA Sequence : | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens ] |
| Official Symbol | FGF2 |
| Synonyms | FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2; |
| Gene ID | 2247 |
| mRNA Refseq | NM_002006 |
| Protein Refseq | NP_001997 |
| MIM | 134920 |
| UniProt ID | P09038 |
| ◆ Recombinant Proteins | ||
| FGF2-2185C | Recombinant Cattle FGF2 Protein, His-tagged | +Inquiry |
| FGF2-1988R | Recombinant Rat FGF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fgf2-397F | Active Recombinant Rat Fgf2 Protein (146 aa) | +Inquiry |
| FGF2-014O | Recombinant Human FGF2 | +Inquiry |
| FGF2-5632C | Recombinant Chicken FGF2 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| FGF2-34B | Active Native Bovine bFGF | +Inquiry |
| FGF2-26551TH | Native Human FGF2 | +Inquiry |
| FGF2-046H | Active Recombinant Human FGF2 Protein | +Inquiry |
| FGF2-065C | Recombinant Chicken FGF Basic Protein, Tag Free | +Inquiry |
| FGF2-066D | Recombinant Duck FGF Basic Protein, Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *
