Active Recombinant Human FGF5 Protein

Cat.No. : FGF5-89H
Product Overview : Recombinant Human FGF5 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Fibroblast growth factor 5 (FGF-5) is a secreted heparin-binding growth factor that binds to FGF receptors 1 and 2 (FGFR1 and FGFR2). FGF-5 is expressed in the mesenchyme, skeletal muscles, central nervous system, and hair follicles to promote cell differentiation and proliferation. FGF-5 functions as a regulatory factor during hair elongation and skeletal muscle development.
Bio-activity : 3T3 Proliferation w 1 ug heparin, ≤10 ng/mL; ≥1.0 x 10^5 units/mg
Molecular Mass : Monomer, 27.7 kDa (252 aa)
AA Sequence : MAWAHGEKRLAPKGQPGPAATDRNPIGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKNPPSPIKSKIPLSAPRKNTNSVKYRLKFRFG
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate and 100 mM sodium chloride, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name FGF5 fibroblast growth factor 5 [ Homo sapiens (human) ]
Official Symbol FGF5
Synonyms FGF5; fibroblast growth factor 5; heparin-binding growth factor 5; HBGF-5; Smag-82;
Gene ID 2250
mRNA Refseq NM_004464
Protein Refseq NP_004455
MIM 165190
UniProt ID P12034

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF5 Products

Required fields are marked with *

My Review for All FGF5 Products

Required fields are marked with *

0
cart-icon
0
compare icon