Recombinant Human FGF5 protein(21-268aa), His-GST&Myc-tagged
| Cat.No. : | FGF5-7539H |
| Product Overview : | Recombinant Human FGF5 protein(P12034)(21-268aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His&Myc |
| Protein Length : | 21-268aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 62.4 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | HGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG |
| Gene Name | FGF5 fibroblast growth factor 5 [ Homo sapiens ] |
| Official Symbol | FGF5 |
| Synonyms | FGF5; fibroblast growth factor 5; heparin-binding growth factor 5; HBGF-5; Smag-82; |
| Gene ID | 2250 |
| mRNA Refseq | NM_004464 |
| Protein Refseq | NP_004455 |
| MIM | 165190 |
| UniProt ID | P12034 |
| ◆ Recombinant Proteins | ||
| FGF5-172H | Recombinant Human Fibroblast Growth Factor 5 | +Inquiry |
| FGF5-97H | Active Recombinant Human FGF5 Protein (Ala18-Gly268), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| FGF5-7539H | Recombinant Human FGF5 protein(21-268aa), His-GST&Myc-tagged | +Inquiry |
| FGF5-89H | Active Recombinant Human FGF5 Protein | +Inquiry |
| FGF5-4835HF | Recombinant Full Length Human FGF5 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF5-6239HCL | Recombinant Human FGF5 293 Cell Lysate | +Inquiry |
| FGF5-6238HCL | Recombinant Human FGF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF5 Products
Required fields are marked with *
My Review for All FGF5 Products
Required fields are marked with *
