Recombinant Human FGFBP1 protein, T7/His-tagged

Cat.No. : FGFBP1-53H
Product Overview : Recombinant human FGFBP1 cDNA (24 – 234 aa, derived from BC008910) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 24-234 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFKKKVKNGLHSKVVSEQKDTLGNTQIKQKSRPGNKGKFVTKDQANCR WAATEQEEGISLKVECTQLDHEFSCVFAGNPTSCLKLKDERVYWKQVARNLRSQKDICRYSKTAVKTRVCRKDFP ESSLKLVSSTLFGNTKPRKEKTEMSPREHIKGKETTPSSLAVTQTMATKAPECVEDPDMANQRKTALEFCGETWS SLCTFFLSIVQDTSC
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro FGFBP1 protein mediated tumor endothelial cell differentiation regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for FGFBP1 protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. May be used for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name FGFBP1 fibroblast growth factor binding protein 1 [ Homo sapiens ]
Official Symbol FGFBP1
Synonyms FGFBP1; fibroblast growth factor binding protein 1; fibroblast growth factor-binding protein 1; FGFBP; HBP17; FGF-binding protein 1; 17 kDa HBGF-binding protein; heparin-binding growth factor binding protein; 17 kDa heparin-binding growth factor-binding p
Gene ID 9982
mRNA Refseq NM_005130
Protein Refseq NP_005121
MIM 607737
UniProt ID Q14512
Chromosome Location 4p15.32
Function fibroblast growth factor binding; heparin binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGFBP1 Products

Required fields are marked with *

My Review for All FGFBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon