Recombinant Human FGFBP1 protein, T7/His-tagged
Cat.No. : | FGFBP1-53H |
Product Overview : | Recombinant human FGFBP1 cDNA (24 – 234 aa, derived from BC008910) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 24-234 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFKKKVKNGLHSKVVSEQKDTLGNTQIKQKSRPGNKGKFVTKDQANCR WAATEQEEGISLKVECTQLDHEFSCVFAGNPTSCLKLKDERVYWKQVARNLRSQKDICRYSKTAVKTRVCRKDFP ESSLKLVSSTLFGNTKPRKEKTEMSPREHIKGKETTPSSLAVTQTMATKAPECVEDPDMANQRKTALEFCGETWS SLCTFFLSIVQDTSC |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro FGFBP1 protein mediated tumor endothelial cell differentiation regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for FGFBP1 protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. May be used for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | FGFBP1 fibroblast growth factor binding protein 1 [ Homo sapiens ] |
Official Symbol | FGFBP1 |
Synonyms | FGFBP1; fibroblast growth factor binding protein 1; fibroblast growth factor-binding protein 1; FGFBP; HBP17; FGF-binding protein 1; 17 kDa HBGF-binding protein; heparin-binding growth factor binding protein; 17 kDa heparin-binding growth factor-binding p |
Gene ID | 9982 |
mRNA Refseq | NM_005130 |
Protein Refseq | NP_005121 |
MIM | 607737 |
UniProt ID | Q14512 |
Chromosome Location | 4p15.32 |
Function | fibroblast growth factor binding; heparin binding; protein binding; |
◆ Recombinant Proteins | ||
FGFBP1-2337R | Recombinant Rat FGFBP1 Protein | +Inquiry |
FGFBP1-1524R | Recombinant Rhesus Macaque FGFBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGFBP1-1994R | Recombinant Rat FGFBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGFBP1-1702R | Recombinant Rhesus monkey FGFBP1 Protein, His-tagged | +Inquiry |
FGFBP1-4840HF | Recombinant Full Length Human FGFBP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFBP1-6233HCL | Recombinant Human FGFBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFBP1 Products
Required fields are marked with *
My Review for All FGFBP1 Products
Required fields are marked with *