Recombinant Human FGGY Protein, GST-tagged
Cat.No. : | FGGY-4228H |
Product Overview : | Human FLJ10986 full-length ORF ( NP_060761.2, 1 a.a. - 439 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that phosphorylates carbohydrates such as ribulose, ribitol, and L-arabinitol. Genome-wide association studies in some populations have found an association between polymorphisms in this gene and sporadic amyotrophic lateral sclerosis, but studies of other populations have not been able to replicate this association. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013] |
Molecular Mass : | 74.1 kDa |
AA Sequence : | MWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGGY FGGY carbohydrate kinase domain containing [ Homo sapiens ] |
Official Symbol | FGGY |
Synonyms | FGGY; FGGY carbohydrate kinase domain containing; FGGY carbohydrate kinase domain-containing protein; FLJ10986; RP11-242B9.1; |
Gene ID | 55277 |
mRNA Refseq | NM_001113411 |
Protein Refseq | NP_001106882 |
MIM | 611370 |
UniProt ID | Q96C11 |
◆ Recombinant Proteins | ||
FGGY-49H | Recombinant Human FGGY protein, His-tagged | +Inquiry |
FGGY-4849HF | Recombinant Full Length Human FGGY Protein, GST-tagged | +Inquiry |
FGGY-3243M | Recombinant Mouse FGGY Protein, His (Fc)-Avi-tagged | +Inquiry |
FGGY-12474Z | Recombinant Zebrafish FGGY | +Inquiry |
FGGY-5867M | Recombinant Mouse FGGY Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGGY-6230HCL | Recombinant Human FGGY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGGY Products
Required fields are marked with *
My Review for All FGGY Products
Required fields are marked with *
0
Inquiry Basket