Recombinant Human FH protein, T7/His-tagged
| Cat.No. : | FH-205H |
| Product Overview : | Recombinant human FH cDNA (45-510 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 45-510 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPT PVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEML GGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAV PLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTGLPFVTAPNKFEAL AAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGN HVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGY DKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | FH fumarate hydratase [ Homo sapiens ] |
| Official Symbol | FH |
| Synonyms | FH; fumarate hydratase; fumarate hydratase, mitochondrial; fumarase; MCL; LRCC; HLRCC; MCUL1; |
| Gene ID | 2271 |
| mRNA Refseq | NM_000143 |
| Protein Refseq | NP_000134 |
| MIM | 136850 |
| UniProt ID | P07954 |
| Chromosome Location | 1q42.1 |
| Pathway | Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate =>oxaloacetate, organism-specific biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate, conserved biosystem; Citric acid cycle (TCA cycle), organism-specific biosystem; |
| Function | fumarate hydratase activity; lyase activity; |
| ◆ Recombinant Proteins | ||
| FH-165H | Recombinant Human FH, His-tagged | +Inquiry |
| FH-11198Z | Recombinant Zebrafish FH | +Inquiry |
| FH-205H | Recombinant Human FH protein, T7/His-tagged | +Inquiry |
| FH-28102TH | Recombinant Human FH | +Inquiry |
| FH-408H | Recombinant Human FH protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| fH-10R | Native Rat fH Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FH-6227HCL | Recombinant Human FH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FH Products
Required fields are marked with *
My Review for All FH Products
Required fields are marked with *
