Recombinant Human FHIT Protein, GST-tagged

Cat.No. : FHIT-4159H
Product Overview : Human FHIT partial ORF ( AAH32336, 31 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene, a member of the histidine triad gene family, encodes a diadenosine 5,5-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FHIT fragile histidine triad [ Homo sapiens ]
Official Symbol FHIT
Synonyms FHIT; fragile histidine triad; fragile histidine triad gene; bis(5-adenosyl)-triphosphatase; AP3Aase; FRA3B; AP3A hydrolase; tumor suppressor protein; dinucleosidetriphosphatase; diadenosine 5,5-P1,P3-triphosphate hydrolase;
Gene ID 2272
mRNA Refseq NM_001166243
Protein Refseq NP_001159715
MIM 601153
UniProt ID P49789

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FHIT Products

Required fields are marked with *

My Review for All FHIT Products

Required fields are marked with *

0
cart-icon