Recombinant Human FHIT Protein, GST-tagged
Cat.No. : | FHIT-4159H |
Product Overview : | Human FHIT partial ORF ( AAH32336, 31 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene, a member of the histidine triad gene family, encodes a diadenosine 5,5-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FHIT fragile histidine triad [ Homo sapiens ] |
Official Symbol | FHIT |
Synonyms | FHIT; fragile histidine triad; fragile histidine triad gene; bis(5-adenosyl)-triphosphatase; AP3Aase; FRA3B; AP3A hydrolase; tumor suppressor protein; dinucleosidetriphosphatase; diadenosine 5,5-P1,P3-triphosphate hydrolase; |
Gene ID | 2272 |
mRNA Refseq | NM_001166243 |
Protein Refseq | NP_001159715 |
MIM | 601153 |
UniProt ID | P49789 |
◆ Recombinant Proteins | ||
FHIT-4358H | Recombinant Human Fragile Histidine Triad, GST-Tagged | +Inquiry |
FHIT-997M | Recombinant Mouse FHIT Protein (2-150 aa), His-tagged | +Inquiry |
FHIT-5874M | Recombinant Mouse FHIT Protein | +Inquiry |
FHIT-0840H | Recombinant Human FHIT Protein (M1-Q147), His/Strep tagged | +Inquiry |
Fhit-3010M | Recombinant Mouse Fhit Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FHIT-6226HCL | Recombinant Human FHIT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FHIT Products
Required fields are marked with *
My Review for All FHIT Products
Required fields are marked with *