Recombinant Human FHL5 Protein, GST-tagged
Cat.No. : | FHL5-4165H |
Product Overview : | Human FHL5 full-length ORF ( AAH21723, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. [provided by RefSeq |
Molecular Mass : | 56.98 kDa |
AA Sequence : | MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSDCRKDLCEEQFMSRDDYPFCMDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FHL5 four and a half LIM domains 5 [ Homo sapiens ] |
Official Symbol | FHL5 |
Synonyms | FHL5; four and a half LIM domains 5; four and a half LIM domains protein 5; ACT; dJ393D12.2; FLJ33049; FHL-5; 1700027G07Rik; LIM protein ACT; activator of CREM in testis; activator of cAMP-responsive element modulator in testis; activator of cAMP-responsive element modulator (CREM) in testis; RP3-393D12.2; KIAA0776; |
Gene ID | 9457 |
mRNA Refseq | NM_001170807 |
Protein Refseq | NP_001164278 |
MIM | 605126 |
UniProt ID | Q5TD97 |
◆ Recombinant Proteins | ||
FHL5-4165H | Recombinant Human FHL5 Protein, GST-tagged | +Inquiry |
FHL5-2002R | Recombinant Rat FHL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
FHL5-542H | Recombinant Human FHL5 Protein, GST-His-tagged | +Inquiry |
FHL5-526C | Recombinant Cynomolgus FHL5 Protein, His-tagged | +Inquiry |
FHL5-5095C | Recombinant Chicken FHL5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FHL5-6221HCL | Recombinant Human FHL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FHL5 Products
Required fields are marked with *
My Review for All FHL5 Products
Required fields are marked with *
0
Inquiry Basket