Recombinant Human FHL5 Protein, GST-tagged

Cat.No. : FHL5-4165H
Product Overview : Human FHL5 full-length ORF ( AAH21723, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. [provided by RefSeq
Molecular Mass : 56.98 kDa
AA Sequence : MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSDCRKDLCEEQFMSRDDYPFCMDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FHL5 four and a half LIM domains 5 [ Homo sapiens ]
Official Symbol FHL5
Synonyms FHL5; four and a half LIM domains 5; four and a half LIM domains protein 5; ACT; dJ393D12.2; FLJ33049; FHL-5; 1700027G07Rik; LIM protein ACT; activator of CREM in testis; activator of cAMP-responsive element modulator in testis; activator of cAMP-responsive element modulator (CREM) in testis; RP3-393D12.2; KIAA0776;
Gene ID 9457
mRNA Refseq NM_001170807
Protein Refseq NP_001164278
MIM 605126
UniProt ID Q5TD97

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FHL5 Products

Required fields are marked with *

My Review for All FHL5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon