Recombinant Human FHL5 Protein, GST-tagged
| Cat.No. : | FHL5-4165H |
| Product Overview : | Human FHL5 full-length ORF ( AAH21723, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. [provided by RefSeq |
| Molecular Mass : | 56.98 kDa |
| AA Sequence : | MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSDCRKDLCEEQFMSRDDYPFCMDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FHL5 four and a half LIM domains 5 [ Homo sapiens ] |
| Official Symbol | FHL5 |
| Synonyms | FHL5; four and a half LIM domains 5; four and a half LIM domains protein 5; ACT; dJ393D12.2; FLJ33049; FHL-5; 1700027G07Rik; LIM protein ACT; activator of CREM in testis; activator of cAMP-responsive element modulator in testis; activator of cAMP-responsive element modulator (CREM) in testis; RP3-393D12.2; KIAA0776; |
| Gene ID | 9457 |
| mRNA Refseq | NM_001170807 |
| Protein Refseq | NP_001164278 |
| MIM | 605126 |
| UniProt ID | Q5TD97 |
| ◆ Recombinant Proteins | ||
| FHL5-271C | Recombinant Cynomolgus Monkey FHL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FHL5-542H | Recombinant Human FHL5 Protein, GST-His-tagged | +Inquiry |
| FHL5-1221Z | Recombinant Zebrafish FHL5 | +Inquiry |
| FHL5-2346R | Recombinant Rat FHL5 Protein | +Inquiry |
| FHL5-4970HF | Recombinant Full Length Human FHL5 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FHL5-6221HCL | Recombinant Human FHL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FHL5 Products
Required fields are marked with *
My Review for All FHL5 Products
Required fields are marked with *
