Recombinant Human FIBP protein, His-tagged
Cat.No. : | FIBP-12893H |
Product Overview : | Recombinant Human FIBP protein(1-357 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-357 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | FIBP fibroblast growth factor (acidic) intracellular binding protein [ Homo sapiens ] |
Official Symbol | FIBP |
Synonyms | FIBP; fibroblast growth factor (acidic) intracellular binding protein; acidic fibroblast growth factor intracellular-binding protein; FGFIBP; aFGF intracellular-binding protein; FGF-1 intracellular-binding protein; FIBP-1; |
mRNA Refseq | NM_004214 |
Protein Refseq | NP_004205 |
MIM | 608296 |
UniProt ID | O43427 |
Gene ID | 9158 |
◆ Recombinant Proteins | ||
FIBP-3258H | Recombinant Human FIBP Protein (Leu14-Val215), N-His tagged | +Inquiry |
FIBP-2919H | Recombinant Human FIBP protein, His-SUMO-tagged | +Inquiry |
FIBP-3257H | Recombinant Human FIBP Protein (Met1-Asp357) | +Inquiry |
FIBP-7822H | Recombinant Human FIBP protein, GST-tagged | +Inquiry |
FIBP-4980HF | Recombinant Full Length Human FIBP Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FIBP Products
Required fields are marked with *
My Review for All FIBP Products
Required fields are marked with *
0
Inquiry Basket