Species : |
Human |
Source : |
Yeast |
Tag : |
HA |
Description : |
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. |
Tag : |
N-HA |
Form : |
Lyophilized |
Molecular Mass : |
18.2 kDa |
AA Sequence : |
YPYDVPDYAAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Endotoxin : |
< 0.2 EU/μg of protein as determined by the LAL method. |
Purity : |
0.98 |
Storage : |
Stable for at least one year at -20 centigrade. Upon reconstitution FGF2 can be stored at +4 centigrade for 2 weeks or at -20 centigrade for 6 months. |
Concentration : |
120 μg/μL |
Storage Buffer : |
20mM potassium phosphate, pH 7.0 |
Reconstitution : |
Spin the vial briefly, add distilled sterile water. |