Recombinant Human fibroblast growth factor 2 (basic) Protein, HA tagged
Cat.No. : | FGF2-57H |
Product Overview : | Recombinant Human FGF2 Protein with HA tag was expressed in Yeast (animal free media and environment). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | HA |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. |
Tag : | N-HA |
Form : | Lyophilized |
Molecular Mass : | 18.2 kDa |
AA Sequence : | YPYDVPDYAAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Endotoxin : | < 0.2 EU/μg of protein as determined by the LAL method. |
Purity : | 0.98 |
Storage : | Stable for at least one year at -20 centigrade. Upon reconstitution FGF2 can be stored at +4 centigrade for 2 weeks or at -20 centigrade for 6 months. |
Concentration : | 120 μg/μL |
Storage Buffer : | 20mM potassium phosphate, pH 7.0 |
Reconstitution : | Spin the vial briefly, add distilled sterile water. |
Gene Name | FGF2 fibroblast growth factor 2 (basic) [Homo sapiens (human)] |
Official Symbol | FGF2 |
Synonyms | FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2 |
Gene ID | 2247 |
mRNA Refseq | NM_002006 |
Protein Refseq | NP_001997 |
MIM | 134920 |
UniProt ID | P09038 |
◆ Recombinant Proteins | ||
FGF2-77H | Recombinant Active Human FGF2 Protein, His-tagged(N-ter) | +Inquiry |
FGF2-2186C | Recombinant Cattle FGF2 Protein, His-tagged | +Inquiry |
FGF2-4381B | Recombinant Bovine FGF2 Protein | +Inquiry |
FGF2-044H | Active Recombinant Human FGF2 Protein | +Inquiry |
FGF2-06B | Recombinant Bovine/Porcine FGF2 Protein | +Inquiry |
◆ Native Proteins | ||
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *
0
Inquiry Basket