Recombinant Human FIS1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FIS1-4729H |
Product Overview : | FIS1 MS Standard C13 and N15-labeled recombinant protein (NP_057152) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission. |
Molecular Mass : | 16.9 kDa |
AA Sequence : | MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FIS1 fission, mitochondrial 1 [ Homo sapiens (human) ] |
Official Symbol | FIS1 |
Synonyms | FIS1; fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae); fission 1 (mitochondrial outer membrane) homolog (yeast), tetratricopeptide repeat domain 11, TTC11; mitochondrial fission 1 protein; CGI 135; CGI 135 protein; Fis1; H_NH0132A01.6; hFis1; FIS1 homolog; TPR repeat protein 11; tetratricopeptide repeat domain 11; tetratricopeptide repeat protein 11; TTC11; CGI-135; |
Gene ID | 51024 |
mRNA Refseq | NM_016068 |
Protein Refseq | NP_057152 |
MIM | 609003 |
UniProt ID | Q9Y3D6 |
◆ Recombinant Proteins | ||
FIS1-31248TH | Recombinant Human FIS1, His-tagged | +Inquiry |
FIS1-5115HF | Recombinant Full Length Human FIS1 Protein, GST-tagged | +Inquiry |
FIS1-1535R | Recombinant Rhesus Macaque FIS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FIS1-917H | Recombinant Human FIS1 | +Inquiry |
FIS1-2008R | Recombinant Rat FIS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FIS1-6216HCL | Recombinant Human FIS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FIS1 Products
Required fields are marked with *
My Review for All FIS1 Products
Required fields are marked with *