Recombinant Human FIS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FIS1-4729H
Product Overview : FIS1 MS Standard C13 and N15-labeled recombinant protein (NP_057152) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission.
Molecular Mass : 16.9 kDa
AA Sequence : MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FIS1 fission, mitochondrial 1 [ Homo sapiens (human) ]
Official Symbol FIS1
Synonyms FIS1; fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae); fission 1 (mitochondrial outer membrane) homolog (yeast), tetratricopeptide repeat domain 11, TTC11; mitochondrial fission 1 protein; CGI 135; CGI 135 protein; Fis1; H_NH0132A01.6; hFis1; FIS1 homolog; TPR repeat protein 11; tetratricopeptide repeat domain 11; tetratricopeptide repeat protein 11; TTC11; CGI-135;
Gene ID 51024
mRNA Refseq NM_016068
Protein Refseq NP_057152
MIM 609003
UniProt ID Q9Y3D6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FIS1 Products

Required fields are marked with *

My Review for All FIS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon