"FKBP3" Related Products

Expand
Expand
Expand

Recombinant Human FKBP3 Protein, GST-tagged

Cat.No.: FKBP3-4190H
Product Overview: Human FKBP3 full-length ORF ( AAH16288, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 50.38 kDa
AA Sequence: MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKEKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ]
Official Symbol: FKBP3
Synonyms: FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase; rotamase; 25 kDa FKBP; PPIase FKBP3; immunophilin FKBP25; rapamycin binding protein; 25 kDa FK506-binding protein; FK506-binding protein 3 (25kD); FK506-binding protein 25, T-cell; rapamycin-selective 25 kDa immunophilin; FKBP-3; FKBP25; FKBP-25;
Gene ID: 2287
mRNA Refseq: NM_002013
Protein Refseq: NP_002004
MIM: 186947
UniProt ID: Q00688

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.