Recombinant Human FKBP7, His-tagged

Cat.No. : FKBP7-173H
Product Overview : Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP7/FKBP7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Leu222) of Human FKBP7 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 24-222 a.a.
Description : Peptidyl-Prolyl Cis-Trans Isomerase FKBP7 (FKBP7) is a member of the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. FKBP7 contains two EF-hand domains and one PPIase FKBP-type domain. FKBP7 exhibits PPIase activity and function as molecular chaperones. In addition, FKBP7 accelerates the folding of proteins during protein synthesis. It has been shown that Hsp90 complex to the nucleus bind its PPIase domain to cytoplasmic dynein, the motor protein responsible for retrograde movement along microtubules.
AA Sequence : QRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLG VGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIET FKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQ HDELVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name FKBP7 FK506 binding protein 7 [ Homo sapiens ]
Official Symbol FKBP7
Synonyms FKBP7; FK506 binding protein 7; peptidyl-prolyl cis-trans isomerase FKBP7; FKBP23; FKBP-7; FKBP-23; rotamase; 23 kDa FKBP; PPIase FKBP7; FK506-binding protein 7; FK506-binding protein 23; 23 kDa FK506-binding protein; PPIase; MGC9420;
Gene ID 51661
mRNA Refseq NM_001135212
Protein Refseq NP_001128684
MIM 607062
UniProt ID Q9Y680
Chromosome Location 2q31.2
Function FK506 binding; calcium ion binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FKBP7 Products

Required fields are marked with *

My Review for All FKBP7 Products

Required fields are marked with *

0
cart-icon