Recombinant Human FKBP7, His-tagged
Cat.No. : | FKBP7-173H |
Product Overview : | Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP7/FKBP7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Leu222) of Human FKBP7 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-222 a.a. |
Description : | Peptidyl-Prolyl Cis-Trans Isomerase FKBP7 (FKBP7) is a member of the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. FKBP7 contains two EF-hand domains and one PPIase FKBP-type domain. FKBP7 exhibits PPIase activity and function as molecular chaperones. In addition, FKBP7 accelerates the folding of proteins during protein synthesis. It has been shown that Hsp90 complex to the nucleus bind its PPIase domain to cytoplasmic dynein, the motor protein responsible for retrograde movement along microtubules. |
AA Sequence : | QRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLG VGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIET FKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQ HDELVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | FKBP7 FK506 binding protein 7 [ Homo sapiens ] |
Official Symbol | FKBP7 |
Synonyms | FKBP7; FK506 binding protein 7; peptidyl-prolyl cis-trans isomerase FKBP7; FKBP23; FKBP-7; FKBP-23; rotamase; 23 kDa FKBP; PPIase FKBP7; FK506-binding protein 7; FK506-binding protein 23; 23 kDa FK506-binding protein; PPIase; MGC9420; |
Gene ID | 51661 |
mRNA Refseq | NM_001135212 |
Protein Refseq | NP_001128684 |
MIM | 607062 |
UniProt ID | Q9Y680 |
Chromosome Location | 2q31.2 |
Function | FK506 binding; calcium ion binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; |
◆ Recombinant Proteins | ||
FKBP7-2349H | Recombinant Human FKBP7 Protein, MYC/DDK-tagged | +Inquiry |
FKBP7-523H | Recombinant Human FKBP7 Protein, Fc-tagged | +Inquiry |
Fkbp7-1286M | Recombinant Mouse Fkbp7 protein, His-tagged | +Inquiry |
FKBP7-8565H | Recombinant Human FKBP7, Fc-tagged | +Inquiry |
FKBP7-4196H | Recombinant Human FKBP7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP7-1314HCL | Recombinant Human FKBP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP7 Products
Required fields are marked with *
My Review for All FKBP7 Products
Required fields are marked with *
0
Inquiry Basket