Recombinant Human FKBP9 Protein, GST-tagged

Cat.No. : FKBP9-4199H
Product Overview : Human FKBP9 full-length ORF (BAG54697.1, 1 a.a. - 570 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FKBP9 (FK506 Binding Protein 9) is a Protein Coding gene. Among its related pathways are Chaperonin-mediated protein folding and Metabolism of proteins. GO annotations related to this gene include calcium ion binding and FK506 binding. An important paralog of this gene is FKBP10.
Molecular Mass : 89.5 kDa
AA Sequence : MAFRGWRPPPPQLLLLLLWVTGQAAPVAGLGSDAELQIERRFVPDECPRTVRSGDFVRYHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLITGMDQALVGMCVNERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGTFLDGTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLHNPKDSISIENKVVPENCERISQSGDFLRYHYNGTLLDGTLFDSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVFDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FKBP9 FK506 binding protein 9, 63 kDa [ Homo sapiens ]
Official Symbol FKBP9
Synonyms FKBP9; FK506 binding protein 9, 63 kDa; FK506 binding protein 9 (63 kD); peptidyl-prolyl cis-trans isomerase FKBP9; FKBP60; FKBP63; FKBP-9; FKBP-63; rotamase; 63 kDa FKBP; PPIase FKBP9; FK506-binding protein 9; 63 kDa FK506-binding protein; PPIase; MGC126772; MGC138258; DKFZp586B1723;
Gene ID 11328
mRNA Refseq NM_007270
Protein Refseq NP_009201
MIM 616257
UniProt ID O95302

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FKBP9 Products

Required fields are marked with *

My Review for All FKBP9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon