Recombinant Human FKBP9 Protein, GST-tagged
Cat.No. : | FKBP9-4199H |
Product Overview : | Human FKBP9 full-length ORF (BAG54697.1, 1 a.a. - 570 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FKBP9 (FK506 Binding Protein 9) is a Protein Coding gene. Among its related pathways are Chaperonin-mediated protein folding and Metabolism of proteins. GO annotations related to this gene include calcium ion binding and FK506 binding. An important paralog of this gene is FKBP10. |
Molecular Mass : | 89.5 kDa |
AA Sequence : | MAFRGWRPPPPQLLLLLLWVTGQAAPVAGLGSDAELQIERRFVPDECPRTVRSGDFVRYHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLITGMDQALVGMCVNERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGTFLDGTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLHNPKDSISIENKVVPENCERISQSGDFLRYHYNGTLLDGTLFDSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVFDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKBP9 FK506 binding protein 9, 63 kDa [ Homo sapiens ] |
Official Symbol | FKBP9 |
Synonyms | FKBP9; FK506 binding protein 9, 63 kDa; FK506 binding protein 9 (63 kD); peptidyl-prolyl cis-trans isomerase FKBP9; FKBP60; FKBP63; FKBP-9; FKBP-63; rotamase; 63 kDa FKBP; PPIase FKBP9; FK506-binding protein 9; 63 kDa FK506-binding protein; PPIase; MGC126772; MGC138258; DKFZp586B1723; |
Gene ID | 11328 |
mRNA Refseq | NM_007270 |
Protein Refseq | NP_009201 |
MIM | 616257 |
UniProt ID | O95302 |
◆ Recombinant Proteins | ||
Fkbp9-3031M | Recombinant Mouse Fkbp9 Protein, Myc/DDK-tagged | +Inquiry |
FKBP9-2094H | Recombinant Human FKBP9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FKBP9-2348H | Recombinant Human FKBP9 Protein, MYC/DDK-tagged | +Inquiry |
FKBP9-2358R | Recombinant Rat FKBP9 Protein | +Inquiry |
FKBP9-3272M | Recombinant Mouse FKBP9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FKBP9 Products
Required fields are marked with *
My Review for All FKBP9 Products
Required fields are marked with *
0
Inquiry Basket