Recombinant Human FKRP Protein, GST-tagged
Cat.No. : | FKRP-4204H |
Product Overview : | Human FKRP partial ORF ( NP_077277.1, 396 a.a. - 494 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein which is targeted to the medial Golgi apparatus and is necessary for posttranslational modification of dystroglycan. Mutations in this gene have been associated with congenital muscular dystrophy, mental retardation, and cerebellar cysts. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | KAVEGDFFRVQYSESNHLHVDLWPFYPRNGVMTKDTWLDHRQDVEFPEHFLQPLVPLPFAGFVAQAPNNYRRFLELKFGPGVIENPQYPNPALLSLTGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKRP fukutin related protein [ Homo sapiens (human) ] |
Official Symbol | FKRP |
Synonyms | Fkrp; FKRP_HUMAN; FLJ12576; Fukutin related protein; Fukutin-related protein; LGMD2I; MDC1C; MGC2991; |
Gene ID | 79147 |
mRNA Refseq | NM_001039885 |
Protein Refseq | NP_001034974 |
MIM | 606596 |
UniProt ID | Q9H9S5 |
◆ Recombinant Proteins | ||
FKRP-5915M | Recombinant Mouse FKRP Protein | +Inquiry |
FKRP-5590Z | Recombinant Zebrafish FKRP | +Inquiry |
Fkrp-3033M | Recombinant Mouse Fkrp Protein, Myc/DDK-tagged | +Inquiry |
FKRP-918H | Recombinant Human FKRP Protein, His (Fc)-Avi-tagged | +Inquiry |
FKRP-4204H | Recombinant Human FKRP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKRP-6199HCL | Recombinant Human FKRP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FKRP Products
Required fields are marked with *
My Review for All FKRP Products
Required fields are marked with *
0
Inquiry Basket