Recombinant Human FKRP Protein, GST-tagged

Cat.No. : FKRP-8893H
Product Overview : Human FKRP partial ORF ( NP_077277.1, 396 a.a. - 494 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein which is targeted to the medial Golgi apparatus and is necessary for posttranslational modification of dystroglycan. Mutations in this gene have been associated with congenital muscular dystrophy, cognitive disability, and cerebellar cysts. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Molecular Mass : 36.63 kDa
AA Sequence : KAVEGDFFRVQYSESNHLHVDLWPFYPRNGVMTKDTWLDHRQDVEFPEHFLQPLVPLPFAGFVAQAPNNYRRFLELKFGPGVIENPQYPNPALLSLTGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FKRP fukutin related protein [ Homo sapiens (human) ]
Official Symbol FKRP
Synonyms FKRP; fukutin related protein; FKTR; MDC1C; LGMD2I; LGMDR9; MDDGA5; MDDGB5; MDDGC5; ribitol 5-phosphate transferase FKRP; ribitol-5-phosphate transferase
Gene ID 79147
mRNA Refseq NM_024301
Protein Refseq NP_077277
MIM 606596
UniProt ID Q9H9S5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FKRP Products

Required fields are marked with *

My Review for All FKRP Products

Required fields are marked with *

0
cart-icon