Recombinant Human FLI1 protein, His-tagged
| Cat.No. : | FLI1-3729H |
| Product Overview : | Recombinant Human FLI1 protein(195-262 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 195-262 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | RESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNTEQRPQPDP |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FLI1 Friend leukemia virus integration 1 [ Homo sapiens ] |
| Official Symbol | FLI1 |
| Synonyms | FLI1; Friend leukemia virus integration 1; Friend leukemia integration 1 transcription factor; EWSR2; SIC 1; proto-oncogene Fli-1; transcription factor ERGB; SIC-1; |
| Gene ID | 2313 |
| mRNA Refseq | NM_001167681 |
| Protein Refseq | NP_001161153 |
| MIM | 193067 |
| UniProt ID | Q01543 |
| ◆ Recombinant Proteins | ||
| FLI1-758H | Recombinant Human FLI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FLI1-3277M | Recombinant Mouse FLI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FLI1-001H | Recombinant Human Fli-1 proto-oncogene, ETS transcription factor Protein, His-tagged | +Inquiry |
| FLI1-2831H | Recombinant Human FLI1 Protein (Met1-Glu196), N-His tagged | +Inquiry |
| FLI1-12924H | Recombinant Human FLI1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FLI1-6195HCL | Recombinant Human FLI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLI1 Products
Required fields are marked with *
My Review for All FLI1 Products
Required fields are marked with *
