Recombinant Human FLI1 protein, His-tagged
Cat.No. : | FLI1-3729H |
Product Overview : | Recombinant Human FLI1 protein(195-262 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 195-262 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNTEQRPQPDP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FLI1 Friend leukemia virus integration 1 [ Homo sapiens ] |
Official Symbol | FLI1 |
Synonyms | FLI1; Friend leukemia virus integration 1; Friend leukemia integration 1 transcription factor; EWSR2; SIC 1; proto-oncogene Fli-1; transcription factor ERGB; SIC-1; |
Gene ID | 2313 |
mRNA Refseq | NM_001167681 |
Protein Refseq | NP_001161153 |
MIM | 193067 |
UniProt ID | Q01543 |
◆ Recombinant Proteins | ||
FLI1-001H | Recombinant Human Fli-1 proto-oncogene, ETS transcription factor Protein, His-tagged | +Inquiry |
FLI1-7818H | Recombinant Human FLI1 protein, His & T7-tagged | +Inquiry |
FLI1-4829HF | Recombinant Full Length Human FLI1 Protein, GST-tagged | +Inquiry |
FLI1-286HFL | Recombinant Full Length Human FLI1 Protein, C-Flag-tagged | +Inquiry |
FLI1-12924H | Recombinant Human FLI1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLI1-6195HCL | Recombinant Human FLI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLI1 Products
Required fields are marked with *
My Review for All FLI1 Products
Required fields are marked with *
0
Inquiry Basket